Katalog AGRO SHOW 2013

Komentarze

Transkrypt

Katalog AGRO SHOW 2013
XV
Międzynarodowa Wystawa Rolnicza
Dla rolnika. Dla natury.
2013
KATALOG WYSTAWY
20-23 września 2013 r.
Bednary koło Poznania, gmina Pobiedziska
:8/+ù&<;0#41&19#9;56#9#41.0+%<#
XV INTERNATIONAL AGRICULTURAL EXHIBITION
Bednary 20 - 23 września 2013 r.
87-100 Toruń, ul. Poznańska 118
tel. 56 651 47 40, tel./fax: 56 651 47 44
www.agroshow.pl, e-mail: [email protected]
Opracowanie graficzne i skład:
Boomgaarden Medien Sp. z o.o.
Ruszków Drugi, ul. Wesoła 52
62-604 Kościelec
tel.: 63 261 60 83
fax: 63 272 54 17
e-mail: [email protected]
Druk:
Trans-Druk
Ladies and Gentlemen, welcome to Bednary!
It is the 15th International Agricultural Exhibition AGRO SHOW already!
9G CU VJG 2QNKUJ %JCODGT QH %QOOGTEG HQT #ITKEWNVWTCN /CEJKPGU
CPF(CEKNKVKGUCTGJCRR[VQUGG[QWRCTVKEKRCVKPIKPVJKUGXGPVUQKORQTVCPV
HQT2QNKUJCITKEWNVWTG#UVJGQTICPKUGTCPFVJGJQUVQHVJGNCTIGUVQWVFQQT
CITKEWNVWTCN GZJKDKVKQP KP 'WTQRG YG JQRG VQ OGGV GZRGEVCVKQPU QH CNN QH
[QWDQVJVJQUGYJQXKUKVWUHQTVJGſTUVVKOGCUYGNNCUVJQUGYJQTGVWTPGF
JGTGCICKP9GDGNKGXGVJCV[QWTUVC[KP$GFPCT[YKNNDGCPKPURKTCVKQPHQT
OQFGTPKUKPIHCTOUCITKEWNVWTCNRTQFWEVKQPCPF2QNKUJTWTCNCTGCUTGUWNVKPIKP
9KGUđCY-WLCYC
DGPGſVUHQTVJGYJQNGEQWPVT[
9KEGRTG\GU<CT\æFW
#)41 5*19 KU QWT YKNN VQ UWRRQTV HWTVJGT FGXGNQROGPV QH VJG 2QNKUJ CITK-
6JGKFGCCEEQORCP[KPIWUCNNVJGVKOGUVCTVKPIYKVJVJGſTUVGFKVKQPQH
8KEGRTGUKFGPVQH$QCTF
EWNVWTGCPFTWTCNCTGCUKPETGCUKPIN[QHVGPFGEKFKPIVQWUGOQFGTPVGEJPQNQIKECNKFGCU(QNNQYKPIVJCVEQPVKPWCNVGPFGPE[KVKUKP$GFPCT[YJGTG[QW
JCXGCWPKSWGQRRQTVWPKV[VQDGEQOGCESWCKPVGFYKVJVJGEWVVKPIGFIG
UQNWVKQPU HQT CITKEWNVWTG KPENWFKPI VJG NCVGUV VTCEVQTU OCEJKPGU CPF CRRNKCPEGU HQT CITKEWNVWTG EQPVTKDWVKPI VQ GXGP DGVVGT HCTOKPI CPF JCTXGUVKPI
KPETGCUKPIN[UCVKUH[KPIHTWKVQH[QWTJCTFNCDQWT
*QYGXGT #)41 5*19 OGCPU OQTG VJCP LWUV CP GZJKDKVKQP QH GSWKROGPV CPF OCVGTKCNU HQT CITKEWNVWTCN RTQFWEVKQP +V KU C RNCEG HQT OGGVKPIU
GZEJCPIG QH KFGCU ICKPKPI PGY MPQYNGFIG CPF UMKNNU *GTG GXGT[DQF[
TGICTFNGUUQHVJGKTGZRGTKGPEGCPFQEEWRCVKQPECPDTQCFGPVJGKTJQTK\QPU
CPFDGEQOGEQPXKPEGFVJG[ECPYQTMOQTGGHHGEVKXGN[CPFYKVJDGVVGTTGUWNVU#IQQFVTCFKVKQPQH#)415*19KUVJCVKVJCUDGEQOGCRNCEGYJGTG
HCTOGTUGPVTGRTGPGWTUUEKGPVKUVURTQFWEGTUFKUVTKDWVQTUOGGV9GUVTKXGVQ
OCMG VJGUG OGGVKPIU HTWKVHWN VQ CNN EQPEGTPGF CPF C EQPVTKDWVKQP VQ FGXGNQROGPV QH CITKEWNVWTG QPG QH VJG OQUV KORQTVCPV KPFWUVTKGU KP VJG 2QNKUJGEQPQO[9GCNUQFQPQVHQTIGVCDQWVRWRKNUCPFUVWFGPVUYJQOYG
GPEQWTCIG VQ RCTVKEKRCVG PQV QPN[ KP VJG GZJKDKVKQP DWV CNUQ KP PWOGTQWU
EQORGVKVKQPU6JGHCEVVJCVVGCEJGTUYJQVGCEJVJG[QWVJCDQWVVJGEQPFKVKQPCPFFKTGEVKQPUHQTFGXGNQROGPVQHVJGCITKEWNVWTCNGPIKPGGTKPIECP
CNUQGZRCPFVJGKTRTQHGUUKQPCNMPQYNGFIGFWTKPIVJGKTUVC[KP$GFPCT[KUQH
GSWCNKORQTVCPEG#)415*19KUCNUQCRNCEGYJGTG[QWECPVCNMFKTGEVN[
VQQHſEGTUHTQOVJG/KPKUVT[QH#ITKEWNVWTGCPF4WTCN&GXGNQROGPVCPFHTQO
IQXGTPOGPVCIGPEKGUUWRRQTVKPIVJGCITKEWNVWTG
#)415*19GZRCPFUYKVJGCEJ[GCT6JGPWODGTQHXKUKVQTUGZJKDKVQTU
CPFIQQFUCPFUGTXKEGUQHHGTGFD[VJGOCUYGNNCUCEEQORCP[KPIGXGPVU
ITQYU6JWUCUVJGQTICPKUGTQHVJKUGXGPVYGRTGRCTGFVJGGZJKDKVKQPCTGC
CPFKVUUWTTQWPFKPIUKPCYC[GPCDNKPIGXGT[DQF[VQPQVQPN[CEJKGXGVJGKT
RTQHGUUKQPCNQDLGEVKXGUDWVCNUQVQURGPFVJKUVKOGKPCRNGCUCPVKPVGTGUVKPI
,Î\GH&YQTCMQYUMK
CPF UCHG YC[ 6JG CFCRVGF EQORTGJGPUKXG UQNWVKQPU RTQXGF VQ DG TKIJV
FWTKPIRTGXKQWUGFKVKQPUQHVJGGZJKDKVKQPVJGTGHQTGVJG#)415*19HQTO
9KEGRTG\GU<CT\æFW
TGOCKPUWPEJCPIGFCNVJQWIJYGEQPUVCPVN[KORTQXGKVGXGT[[GCT
8KEGRTGUKFGPVQH$QCTF
#)415*19
1PEGCICKPYGCTGXGT[INCFVQUGG[QWJGTGCPFKPXKVG[QWVQUGG
9KVCO[2CēUVYCY$GFPCTCEJ
6QLWľ:8/KúF\[PCTQFQYC9[UVCYC4QNPKE\C#)415*19
/[LCMQ2QNUMC+\DC)QURQFCTE\C/CU\[PK7T\æF\Gē4QNPKE\[EJEKGU\[O[UKúľGDKGT\GEKG2CēUVYQWF\KCđYVCMYCľP[OFNCRQNUMKGIQTQNPKEVYC
Y[FCT\GPKW ,CMQ QTICPK\CVQT K IQURQFCT\ PCLYKúMU\GL Y 'WTQRKG Y[UVCY[
TQNPKE\GL PC VGTGPKG QVYCTV[O OCO[ PCF\KGLú ľG URGđPKO[ QE\GMKYCPKC
YU\[UVMKEJ2CēUVYCŌ\CTÎYPQV[EJMVÎT\[QFYKGF\CLæPCURQTC\RKGTYU\[
LCMKV[EJMVÎT[EJIQħEKO[RQTC\MQNGLP[9KGT\[O[ľGRQD[VY$GFPCTCEJ
DúF\KG KPURKTCELæ FNC WPQYQE\GħPKCPKC IQURQFCTUVY RTQFWMELK TQNPGL QTC\
RQNUMKGLYUKEQYGHGMEKGRT\[PKGUKGMQT\[ħEKECđGOWMTCLQYK
#NGMUCPFTC)TCNKM
+FGæMVÎTCRT\G\ECđ[E\CUVQYCT\[U\[PCORQE\[PCLæEQFRKGTYU\GL
GF[ELK#)415*19LGUVEJúèYURKGTCPKCYFCNU\[OTQ\YQLWRQNUMKGIQTQNPKEVYCKQDU\CTÎYYKGLUMKEJEQTC\RQYU\GEJPKGLFGE[FWLæEGIQUKúPC\CUVQUQYCPKG PQYQE\GUPGL O[ħNK VGEJPKE\PGL <IQFPKG \ Væ UVCđæ VGPFGPELæ
YđCħPKGY$GFPCTCEJW\[UMWLGEKG2CēUVYQPKGRQYVCT\CNPæQMC\Lú\CRQ\PCPKCUKú\PCLPQYQE\GħPKGLU\[OKTQ\YKæ\CPKCOKFNCTQNPKEVYCYV[O\PCLPQYU\[OK EKæIPKMCOK OCU\[PCOK K WT\æF\GPKCOK TQNPKE\[OK MVÎTG RT\[E\[PKCLæ
UKúFQLGU\E\GNGRU\GIQIQURQFCTQYCPKCK\DKGTCPKCEQTC\DCTF\KGLUCV[UHCMELQPWLæE[EJQYQEÎYEKúľMKGLRTCE[
2TG\GU2QNUMKGL+\D[
)QURQFCTE\GL/CU\[P
K7T\æF\Gē4QNPKE\[EJ
2TGUKFGPVQHVJG
2QNKUJ%JCODGT
QH%QOOGTEGHQT#ITKEWNVWTCN
/CEJKPGUCPF(CEKNKVKGU
#)41 5*19 VQ LGFPCM EQħ YKúEGL PKľ V[NMQ Y[UVCYC URT\úVW K OCVGTKCđÎY FQ RTQFWMELK TQNPGL 6Q OKGLUEG URQVMCē Y[OKCP[ RQINæFÎY \FQD[YCPKC YKGF\[ C VCMľG MQNGLP[EJ WOKGLúVPQħEK 6W MCľF[ Ō DG\ Y\INúFW
PCFQħYKCFE\GPKGKEJCTCMVGTY[MQP[YCPGLRTCE[OQľGTQ\U\GT\[èUYQLG
JQT[\QPV[ K PCDTCè RT\GMQPCPKC ľG OQľG F\KCđCè GHGMV[YPKGL K W\[UMKYCè
NGRU\G Y[PKMK &QDTæ VTCF[ELæ UVCđQ UKú DQYKGO ľG RQFE\CU #)41 5*19
URQV[MCLæUKúTQNPKE[RT\GFUKúDKQTE[PCWMQYE[RTQFWEGPEKF[UVT[DWVQT\[
KFQTCFE[%\[PKO[YU\[UVMQCD[VGURQVMCPKCD[đ[QYQEPGFNCYU\[UVMKEJ
KUVCđ[UKúRT\[E\[PMKGOFQTQ\YQLWTQNPKEVYCMVÎTGLGUVLGFPæ\PCLYCľPKGLU\[EJ ICđú\K RQNUMKGL IQURQFCTMK 0KG \CRQOKPCO[ VCMľG Q WE\PKCEJ K UVWFGPVCEJ MVÎT[EJ \CEJúECO[ PKG V[NMQ FQ WE\GUVPKEVYC Y Y[UVCYKG CNG
VCMľGYNKE\P[EJMQPMWTUCEJ4ÎYPKGYCľPGKľRQFE\CURQD[VWY$GFPCTCEJUYQLæHCEJQYæYKGF\úOQIæRQU\GT\[èVCMľGPCWE\[EKGNGRT\GMC\WLæE[OđQF\KGľ[YKGF\úQUVCPKGKMKGTWPMCEJTQ\YQLWVGEJPKMKTQNPKE\GL#)41
5*19VQVCMľGOKGLUEGIF\KGOQľPCDG\RQħTGFPKQRQTQ\OCYKCè\RT\GFUVCYKEKGNCOK/KPKUVGTUVYC4QNPKEVYCK4Q\YQLW9UKQTC\CIGPELKT\æFQY[EJ
F\KCđCLæE[EJPCT\GE\TQNPKEVYC
#)41 5*19 \ TQMW PC TQM UKú TQ\TCUVC %QTC\ YKúEGL LGUV \YKGF\CLæE[EJ Y[UVCYEÎY QHGTQYCP[EJ RT\G\ PKEJ VQYCTÎY K WUđWI QTC\ KORTG\
VQYCT\[U\æE[EJ&NCVGIQLCMQQTICPK\CVQTVGIQY[FCT\GPKCRT\[IQVQYCNKħO[VGTGPY[UVCY[KLGLQVQE\GPKGYVCMKURQUÎDCD[MCľF[PKGV[NMQOÎIđ
\TGCNK\QYCèVWUYQLGEGNG\CYQFQYGCNGVCMľGURúF\KèE\CUOKđQEKGMC-
4GPCVC#TMWU\GYUMC
YKGCRT\[V[ODG\RKGE\PKG2T\[LúVGRT\G\PCUMQORNGMUQYGTQ\YKæ\CPKC
URTCYF\Kđ[UKúRQFE\CURQRT\GFPKEJGF[ELKY[UVCY[FNCVGIQVGľHQTOWđC
#)41 5*19 RQ\QUVCLG DG\ \OKCP EJQè Læ \ TQMW PC TQM MQPUGMYGPVPKG
WFQUMQPCNCO[
,GU\E\GTC\UGTFGE\PKGYKVCO[K\CRTCU\CO[FQ\YKGF\GPKC#)415*19
9KEGRTG\GU<CT\æFW
&[TGMVQT<CT\æF\CLæE[
8KEGRTGUKFGPVQH$QCTF
/CPCIKPI&KTGEVQT
Ladies and Gentlemen!
1PEG CICKP YG OGGV CV VJG :8 +PVGTPCVKQPCN #ITKEWNVWTCN 'ZJKDKVKQP
#)415*19KP$GFPCT[
5VCPKUđCY-CNGODC
6JKU[GCTŏUCPPKXGTUCT[GFKVKQPKUJGNFWPFGTVJGUNQICPő(QTVJGHCTOGT
(QT VJG 0CVWTG ő 6JKU NCTIGUV QWVFQQT GZJKDKVKQP KP 'WTQRG CVVTCEVU CNN VJG
NGCFKPIPCOGUKPVJGKPFWUVT[QHCITKEWNVWTCNVGEJPQNQI[YJQYKUJJGTGVQ
/KPKUVGTQH#ITKEWNVWTG
RTGUGPVVJGKTNCVGUVQHHGTU6QVCNN[GZJKDKVQTUHTQOEQWPVTKGUYKNNDGRTG-
CPF4WTCN&GXGNQROGPV
UGPV6JKUVGUVKſGUVJGTCPMQHVJGGXGPV#ITQ5JQYKP$GFPCT[KUCXGT[IQQF
RNCVHQTOVQEQORCTGVGEJPKSWGCPFKVUKPƀWGPEGQPVJGSWCNKV[QHVJGYQTM
QH KPFKXKFWCN OCEJKPGU CU YGNN CU C XCTKGV[ QH VGEJPQNQIKGU 6JKU KU FWG VQ
VJGCFQRVGFHQTOWNCUJQYOCEJKPGUCVYQTMQPURGEKCNN[RTGRCTGFHQTVJKU
RWTRQUGRTGUGPVCVKQPſGNFU6JKUCNNQYURQVGPVKCNDW[GTUVQſPFQWVFKTGEVN[
CDQWVVJGRQUUKDKNKVKGUQHCOCEJKPGQTFGXKEG
#)415*19KUVTCFKVKQPCNN[VJGUKVGQHOCP[UGOKPCTU+PURGEKCNEQPUWNVKPIUGEVKQPUHCTOGTUECPURGCMYKVJRTQHGUUKQPCNUKPXCTKQWUſGNFU
6JKU[GCTCUKPRTGXKQWU[GCTUCVGZJKDKVKQPYKNNDGVJGſPCNQHVJGEQPVGUVő/GEJCPKEQP/GFCNŒ#NUQVJGVJKTFGFKVKQPQHVJGEQPVGUVő5GTXKEGQP
/GFCNŒYKNNſPKUJŒ(QTVJGſTUVVKOGYKNNDGECTTKGFQWVVJGſPCNGQHő;QWPI
/GEJCPKEQP/GFCNŒ
#TKEJRTQITCOCPFPWOGTQWUCEVKXKVKGUYKNNEGTVCKPN[DTKPIOCP[HCTOGTUHTQO9KGNMQRQNUMCCPFQVJGTTGIKQPUQHVJGEQWPVT[
+ŏOUWTGKVYKNNDGCNQVQHQRRQTVWPKVKGUVQVCNMCDQWV2QNKUJCITKEWNVWTG
KPQTFGTVQFGXGNQRVJGDGUVUQNWVKQPUKPVJGPGYſPCPEKCNRGTURGEVKXG
DGECWUGKVKUCVKOGQHYKFGEQPUWNVCVKQPQPVJGRTKQTKVKGUQHVJGPGY
TWTCNFGXGNQROGPVRTQITCO
*QRKPIHQTEQPUVTWEVKXGHGGFDCEMCPFKFGCU+YKUJ[QWUCVKUHCEVKQPYKVJ
RCTVKEKRCVKQP KP VJG LWDKNGG :8 +PVGTPCVKQPCN #ITKEWNVWTCN 'ZJKDKVKQP #)41
5*19KP$GFPCT[CVVJGJQURKVCNKV[QHVJG9KGNMQRQNUMC
5\CPQYPK2CēUVYQ
2QTC\:8URQV[MCO[UKúPC/KúF\[PCTQFQYGL9[UVCYKG4QNPKE\GL#ITQ
5JQYY$GFPCTCEJ
6GIQTQE\PC LWDKNGWU\QYC GF[ELC QFD[YC UKú RQF JCUđGO œ&NC 4QNPKMC&NC0CVWT[Œ6CPCLYKúMU\CY[UVCYCRNGPGTQYCY'WTQRKGRT\[EKæIC
YU\[UVMKG NKE\æEG UKú ſTO[ \ DTCPľ[ VGEJPKMK TQNPKE\GL MVÎTG EJEæ VWVCL \C-
5VCPKUđCY-CNGODC
RTG\GPVQYCèUYQLæPCLPQYU\æQHGTVúĐæE\PKGDúF\KGY[UVCYEÎY\
MTCLÎY 6Q PCLNGRKGL ħYKCFE\[ Q TCPF\G KORTG\[ #ITQ 5JQY Y $GFPCTCEJ
UVCPQYK DCTF\Q FQDTæ RđCU\E\[\Pú RQTÎYPCYE\æ \CUVQUQYCP[EJ TQ\YKæ\CēVGEJPKE\P[EJKKEJYRđ[YWPCLCMQħèRTCE[RQU\E\GIÎNP[EJOCU\[PC
VCMľGTÎľPQTQFP[EJVGEJPQNQIKK9[PKMCVQ\RT\[LúVGLHQTOWđ[RQMC\WOCU\[PYRTCE[PCURGELCNPKGRT\[IQVQYCP[EJFQVGIQEGNWRQNCEJRQMC\QY[EJ&\KúMKVGOWRQVGPELCNPKPCD[YE[OQIæUKúRT\GMQPCèDG\RQħTGFPKQ
QOQľNKYQħEKCEJFCPGLOCU\[P[NWDWT\æF\GPKC
#)41 5*19 VQ VTCF[E[LPKG TÎYPKGľ OKGLUEG YKGNW UGOKPCTKÎY 0CVQOKCUV Y URGELCNPKG RT\[IQVQYCP[EJ RWPMVCEJ FQTCFE\[EJ TQNPKE[ OQIæ
RQTQ\OCYKCè\HCEJQYECOK\TÎľP[EJF\KGF\KP
2QFE\CUVGIQTQE\PGLGF[ELKRQFQDPKGLCMYNCVCEJWDKGIđ[EJQFDúF\KGUKúſPCđMQPMWTUWœ/GEJCPKMPC/GFCNŒ2QFUWOQYCPC\QUVCPKGVCMľG
VT\GEKCGF[ELCMQPMWTUWœ5GTYKUPC/GFCNŒ2QTC\RKGTYU\[RT\GRTQYCF\QP[
\QUVCPKGPCVQOKCUVſPCđMQPMWTUWœ/đQF[/GEJCPKMPC/GFCNŒ
$QICV[RTQITCOKNKE\PGCVTCMELG\RGYPQħEKæħEKæIPæYKGNWTQNPKMÎY\
9KGNMQRQNUMKQTC\\KPP[EJTGIKQPÎYMTCLW
,GUVGO RT\GMQPCP[ ľG DúF\KG VGľ YKGNG QMC\LK FQ TQ\OÎY Q RQNUMKO
TQNPKEVYKGCD[Y[RTCEQYCèLCMPCLNGRU\GTQ\YKæ\CPKCYPQYGLRGTURGMV[YKGſPCPUQYGLŌIF[ľLGUVVQE\CUU\GTQMKEJMQPUWNVCELKPCVGOCV
RTKQT[VGVÎYYPQY[ORTQITCOKGTQ\YQLWQDU\CTÎYYKGLUMKEJ
.KE\æEPCMQPUVTWMV[YPGQRKPKGKRQO[Uđ[ľ[E\úUCV[UHCMELK\WF\KCđWY
LWDKNGWU\QYGL:8/KúF\[PCTQFQYGL9[UVCYKG4QNPKE\GL#ITQ5JQYY$GFPCTCEJPCIQħEKPPGL<KGOK9KGNMQRQNUMKGL
/KPKUVGT4QNPKEVYC
K4Q\YQLW9UK
+YCTON[YGNEQOGCNNGZJKDKVQTUXKUKVQTUCPFQTICPKUGTUQHVJG+PVGTPCVKQPCN#ITKEWNVWTCN'ZJKDKVKQP#)41 5*19 JGNF HQTVJGſHVGGPVJVKOG
CNTGCF[KP$GFPCT[KP2QDKGF\KUMCEQOOWPG+COJCRR[VQRTGUGPVVQ[QW
VJG2QDKGF\KUMCEQOOWPGQHYJKEJ+COCOC[QTHQTVJGVJKTFVGTO
2QDKGF\KUMCKUNQECVGFQPVJGCPEKGPV2KCUVQYUMK6TCKNJCNHYC[DGVYGGP
2Q\PCPCPF)PKG\PQTKEJYKVJKVUTGUQWTEGUHQTTGIGPGTCVKQPQHDQF[CPF
OKPF(QTVQWTKUVUKVUNQYFGITGGQHWTDCPKUCVKQPCPFNCEMQHNCTIGKPFWUVTKCN
RNCPVUCPFHCEVQTKGUIWCTCPVGGUENGCPCKTCPFTGUVKPCSWKGVCPFRGCEGHWNGPXKTQPOGPV6JGTGIKQPŏUENKOCVGKURQUKVKXGN[KPƀWGPEGFD[YQQFNCPF
CTGCUCPFVJGJ[FTQITCRJKEPGVYQTMQHVJGEQOOWPGHQTOGFD[TKXGTU%[DKPCCPF)đÎYPCNCMGUCPFCDQWVUOCNNGTYCVGTJQNGU6JGCTGCUQH
/KEJCđ2QFUCFC
VJGJKIJGUVGPXKTQPOGPVCNXCNWGYGTGKPENWFGFKPVYQNCPFUECRGRTQVGE-
/C[QT1H2QDKGF\KUMC6QYP
GUV)QVJKEEJWTEJGUKP9KGNMQRQNUMCő1RGPCKT/WUGWOQHVJG2KCUVQYUMK
VKQPRCTMUœ2WU\E\C<KGNQPMCŒCPFœ2TQOPQŒCPFHQWTPCVWTGUCPEVWCTKGU
9QTVJUGGKPICTG5V/KEJCGN#TEJCPIGN%JWTEJDGKPIQPGQHVJGQNF-
CPF%QOOWPG
6TCKN /KPKCVWTGUΠVQIGVJGT YKVJ C JKUVQTKE VQYP CPF GZJKDKVKQP QH /GFKGXCN
UKGIG OCEJKPGU YQQFGP 5V %CVJGTKPG %JWTEJ KP 9úINGYQ YKVJ VJG RKEVWTG QH VJG /QVJGT QH )QF ő6JG .CF[ QH VJG .CMGŒ CPF 0GQ)QVJKE RCNCEGKP-T\GħNKEG(QTRGQRNGRTGHGTTKPIJKMKPIGFWECVKQPCNRCVJUYGTGRTGRCTGFJGNRKPIVQFKUEQXGTVJGNCPFUCPFJKUVQT[QHVJGEQOOWPG9GCNUQ
QRGPGFCPGVYQTMQH0QTFKE9CNMKPIRCVJUKPVJGOQUVKPVGTGUVKPIRCTVUQH
VJGNCPFUECRGRTQVGEVKQPRCTMő2TQOPQŒ+PTGEGPV[GCTUVJGTGJCXGDGGP
PWOGTQWU TGETGCVKQP HCEKNKVKGU EQPUVTWEVGF KP VJG EQOOWPG FGUKIPCVGF
HQT EJKNFTGP [QWVJ CPF YJQNG HCOKNKGU 6JG NCTIGUV CPF VJG OQUV OQFGTP
KPXGUVOGPV KU VJG 4GETGCVKQP %GPVTG HQT 5QEKCN +PVGITCVKQP #PQVJGT NCTIG
KPXGUVOGPVKPVQWTKUOŌő-C[CMKPIVTCKN2WU\E\C<KGNQPMCŒŌTGUWNVGFKPMO
QHCOQFGTPHWNN[CFCRVGFCPFOCTMGFYCVGTVTCKNQPVJGNCMGUDGVYGGP
VQYPU QH 2QDKGF\KUMC CPF 6WE\PQ #XCKNCDNG RKVEJGU PWOGTQWU DGCEJGU
JKMKPI VTCKNU DKE[ENG VTCKNU CPF CRRTQRTKCVG CEEQOOQFCVKQP CPF ECVGTKPI
HCEKNKVKGUOCMG2QDKGF\KUMCQPGQHVJGOQUVCVVTCEVKXGEQOOWPGUKPYJQNG
9KGNMQRQNUMCCPFCPWODGTQHKPXGUVOGPVUKPFGXGNQROGPVQHURQTVUCPF
TGETGCVKQPJCXGDGGPTGEQIPKUGFKPYJQNG2QNCPFD[ITCPVKPI2QDKGF\KUMC
VJG VKVNG QH ő5RQTV %QOOWPGŒ CPF ő#EVKXG 6QYPŒ 2QDKGF\KUMC CTG YQTVJ
XKUKVKPIFWTKPIEWNVWTCNGPVGTVCKPOGPVCPFURQTVUGXGPVUQTICPKUGFJGTG
2QDKGF\KUMCCTGHCOQWUPQVQPN[HQTKVUHQTGUVUENGCTNCMGUCPFDGCWVKHWN
NCPFUECRGDWVCNUQHQTXKIQTQWUN[FGXGNQRKPICITKEWNVWTGTQDWUVGEQPQO[
CPF KPVGTGUVKPI UQEKCN KPKVKCVKXGU 6JQUG XCNWGU JCXG TGUWNVGF KP CPPWCN KPETGCUG KP VJG PWODGT QH PGY KPJCDKVCPVU QXGT VJQWUCPF QH TGIKUVGTGF
RGTUQPUCPFKPXGUVQTUFGXGNQRKPIVJGKTEQORCPKGUCVVJGDGUVKPXGUVOGPV
CTGCUKP9KGNMQRQNUMCHQTYJKEJ2QDKGF\KUMCYCUCYCTFGFCRTGUVKIKQWUVKVNG
ő/GFCNYQTVJ.CPFŒ
YYYRQDKGF\KUMCRN
/C[QT1H2QDKGF\KUMC6QYPCPF%QOOWPG
/KEJCđ2QFUCFC
9KVCOUGTFGE\PKGYU\[UVMKEJY[UVCYEÎY\YKGF\CLæE[EJQTC\QTICPK\CVQTÎY/KúF\[PCTQFQYGL9[UVCY[4QNPKE\GL#)415*19MVÎTCLWľRQ
TC\RKúVPCUV[QFD[YCUKúY$GFPCTCEJPCVGTGPKGIOKP[2QDKGF\KUMC/KđQOK
LGUVRT\GF2CēUVYGO\CRTG\GPVQYCèIOKPú2QDKGF\KUMCMVÎTGLOCO\CU\E\[V
D[èDWTOKUVT\GOLWľVT\GEKæMCFGPELú
0CRTCUVCT[O5\NCMW2KCUVQYUMKOYRQđQYKGFTQIKRQOKúF\[2Q\PCPKGO
C)PKG\PGONGľ[IOKPC2QDKGF\KUMCDQICVCYYCNQT[UđWľæEGTGIGPGTCELKUKđ
ſ\[E\P[EJ K RU[EJKE\P[EJ E\đQYKGMC 0KUMK UVQRKGē WTDCPK\CELK QTC\ DTCM FWľ[EJ\CMđCFÎYRT\GO[UđQY[EJKHCDT[MIYCTCPVWLGVWT[UVQOE\[UVGRQYKGVT\G
QTC\QFRQE\[PGMYEKU\[KURQMQLW0CMNKOCVTGIKQPWRQ\[V[YPKGYRđ[YCLæ
VGTGP[NGħPGQTC\UKGèJ[FTQITCſE\PCIOKP[MVÎTæVYQT\æT\GMK%[DKPCK)đÎYPCLG\KQTKQMPKGYKGNMKEJQE\GMYQFP[EJ0CLCVTCME[LPKGLU\GRT\[TQFPKE\Q VGTGP[ IOKP[ \QUVCđ[ YđæE\QPG FQ FYÎEJ RCTMÎY MTCLQDTC\QY[EJ
/KEJCđ2QFUCFC
œ2WU\E\C<KGNQPMCŒKœ2TQOPQŒQTC\E\VGTGEJTG\GTYCVÎYRT\[TQF[
9CTVQVWVCL\YKGF\Kè-QħEKÎđRYĦY/KEJCđC#TEJCPKQđCPCNGľæE[FQ
PCLUVCTU\[EJ MQħEKQđÎY IQV[EMKEJ Y 9KGNMQRQNUEG œ5MCPUGP /KPKCVWT 5\NCMW
2KCUVQYUMKGIQŒYTC\\Y[DWFQYCP[OQDQMITQFGO\Y[UVCYæħTGFPKQYKGE\P[EJOCU\[PQDNúľPKE\[EJFTGYPKCP[-QħEKÎđRYĦY-CVCT\[P[Y9úINGYKG\QDTC\GO/CVMK$QUMKGLœ2CPK\9[UR[ŒQTC\PGQIQV[EMKRCđCEY-T\GħNKECEJ&NCNWF\KRTGHGTWLæE[EJVWT[UV[MúRKGU\æQRTCEQYCPG\QUVCđ[ħEKGľMK
F[FCMV[E\PGRQ\YCNCLæEGNGRKGLRQ\PCèVGTGP[KJKUVQTKúIOKP[7TWEJQOKQPC\QUVCđCTÎYPKGľUKGèVTCU0QTFKE9CNMKPIRQPCLEKGMCYU\[EJRT\[TQFPKE\Q
\CMæVMCEJ RCTMW MTCLQDTC\QYGIQ 2TQOPQ 9 QUVCVPKEJ NCVCEJ PC VGTGPKG
IOKP[RQYUVCđQYKGNGQDKGMVÎYTGMTGCE[LP[EJRT\G\PCE\QP[EJ\CTÎYPQFNC
F\KGEKOđQF\KGľ[LCMKECđ[EJTQF\KP0CLYKúMU\æKPCLPQYQE\GħPKGLU\æKPYGUV[ELæLGUV4GMTGCE[LPG%GPVTWO+PVGITCELK5RQđGE\PGL-QNGLPCFWľCKPYGUV[ELC
VWT[UV[E\PCœ5\NCM-CLCMQY[2WU\E\C<KGNQPMCŒŌ\CQYQEQYCđCRQYUVCPKGO
MO PQYQE\GUPGIQ Y RGđPK RT\[UVQUQYCPGIQ K Q\PCMQYCPGIQ U\NCMW
VWT[UV[MK YQFPGL PC QDU\CT\G LG\KQT RQOKúF\[ OKGLUEQYQħEKCOK 2QDKGF\KUMC
K 6WE\PQ /QľNKYQħè UMQT\[UVCPKC \ DQKUM URQTVQY[EJ NKE\P[EJ RNCľ RKGU\[EJ
U\NCMÎY VWT[UV[E\P[EJ ħEKGľGM TQYGTQY[EJ QTC\ QFRQYKGFPKC DC\C PQENGIQYC K ICUVTQPQOKE\PC URTCYKCLæ Kľ 2QDKGF\KUMC WYCľCPG Uæ \C LGFPæ \
PCLDCTF\KGLCVTCME[LP[EJIOKPYECđGL9KGNMQRQNUEGCU\GTGIKPYGUV[ELKOCLæE[EJPCEGNWTQ\YÎLURQTVWKTGMTGCELK\QUVCđFQEGPKQP[PCQIÎNPQRQNUMKO
HQTWORQRT\G\RT\[\PCPKG2QDKGF\KUMQOV[VWđÎYœ5RQTVQYC)OKPCŒKœ#MV[YPG /KCUVQŒ 2QDKGF\KUMC YCTVQ LGUV QFYKGF\Kè RQFE\CU QTICPK\QYCP[EJ VW
Y[FCT\GēMWNVWTCNP[EJTQ\T[YMQY[EJKURQTVQY[EJ
2QDKGF\KUMC Uđ[Pæ PKG V[NMQ \ NCUÎY E\[UV[EJ LG\KQT K PKG\Y[Mđ[EJ MTCLQDTC\ÎYCNGTÎYPKGľ\RTúľPKGTQ\YKLCLæEGIQUKúTQNPKEVYCF[PCOKE\PGLIQURQFCTMK K EKGMCY[EJ KPKELCV[Y URQđGE\P[EJ 2QY[ľU\G YCNQT[ Uæ RT\[E\[Pæ
TQUPæEGLEQTQMWNKE\D[QUKGFNCLæE[EJUKúVWVCLPQY[EJOKGU\MCēEÎY
RQPCF
V[U\COGNFQYCP[EJQUÎDCVCMľGKPYGUVQTÎYTQ\YKLCLæE[EJUYQLGRT\GFUKúDKQTUVYCPCPCLNGRU\[EJVGTGPCEJKPYGUV[E[LP[EJY9KGNMQRQNUEG\CMVÎTG
RT\[\PCPQ2QDKGF\KUMQORTGUVKľQY[V[VWđœ)TWPVPCOGFCNŒ
YYYRQDKGF\KUMCRN
$WTOKUVT\/KCUVCK)OKP[2QDKGF\KUMC
/KEJCđ2QFUCFC
$WTOKUVT\/KCUVC
K)OKP[2QDKGF\KUMC
XV International Agricultural Exhibition AGRO SHOW 2013
EVENTS PROGRAMME
During the exhibition there are presentations of machines in individual presentation fields.
Consultation and advising points are organised at the government agencies stands.
Friday, 20 September 2013 (the exhibition is open to visitors from 9:00 a.m. to 5:00 p.m.)
HTQO
#EETGFKVCVKQPQHTGRQTVGTU
2TGUUQHſEG
Ō
2TGUUEQPHGTGPEGQRGPKPIVJGVJ+PVGTPCVKQPCN'ZJKDKVKQP
#)415*19
2TGUUQHſEG
Ō
(KPCNUQHVJGEQORGVKVKQPő/GFCNYQTVJ[;QWPI/GEJCPKEŒ
5GOKPCTTQQO
D[VJGTWPYC[
Ō
(KPCNUQHVJGPFGFKVKQPQHVJGEQORGVKVKQPő/GFCNYQTVJ[
/GEJCPKEŒ
5GOKPCTTQQO
D[VJGTWPYC[
ŌRO
5WOOKPIWRQHVJGVJGFKVKQPQHVJG#NN2QNCPF%QORGVKVKQP
ő5CHG(CTOŒ
5GOKPCTCPFFKPKPITQQO
ŌRO
2TGUGPVCVKQPUQHOCEJKPGUKPVJGTKPIPGYRTQFWEVUNQCFGTU
CPFHTQPVNQCFGTUURTC[GTUVGEJPQNQIKGUHQTRTGEKUKQPHCTOKPI
4+0)ŌRTGUGPVCVKQPſGNF
ŌRO
2TGUGPVCVKQPQHCYCTFUVQNCWTGCVGUQHVJGEQORGVKVKQPU
ő/GFCNYQTVJ[;QWPI/GEJCPKEŒő/GFCNYQTVJ[
/GEJCPKEŒCPFő/GFCNYQTVJ[5GTXKEGŒYKVJ
RCTVKEKRCVKQPQHVJG/KPKUVGTQH#ITKEWNVWTGCPF4WTCN
&GXGNQROGPV
5GOKPCTTQQO
D[VJGTWPYC[
ŌRO
/GGVKPIYKVJVJG/KPKUVGTQH#ITKEWNVWTGCPF4WTCN
&GXGNQROGPV
5GOKPCTTQQO
D[VJGTWPYC[
Saturday, 21 September 2013 (the exhibition is open to visitors from 9:00 a.m. to 5:00 p.m.)
Ō
2TGUGPVCVKQPUQHOCEJKPGUKPVJGTKPI
PGYRTQFWEVUNQCFGTUCPFHTQPVNQCFGTU
URTC[GTUVGEJPQNQIKGUHQTRTGEKUKQPHCTOKPI
4+0)ŌRTGUGPVCVKQPſGNF
Ō
5GOKPCTő6JG2TQITCOOGHQT4WTCN#TGCU&GXGNQROGPV
HQTVJG[GCTUŌCUCUQWTEGQHſPCPEKCNUWRRQTV
YKVJVJG'7HWPFUŒ
5GOKPCTTQQO
D[VJGTWPYC[
Ō
2TGUGPVCVKQPQHCYCTFUKPRNGDKUEKVGUő(CTOGTQHVJG;GCT
ŒCPFő5WRGT*GCFQHVJG8KNNCIGŒ
5GOKPCTCPFFKPKPITQQO
Sunday, 22 September 2013 (the exhibition is open to visitors from 9:00 a.m. to 5:00 p.m.)
Ō
2TGUGPVCVKQPUQHOCEJKPGUKPVJGTKPI
PGYRTQFWEVUNQCFGTUCPFHTQPVNQCFGTU
URTC[GTUVGEJPQNQIKGUHQTRTGEKUKQPHCTOKPI
4+0)ŌRTGUGPVCVKQPſGNF
Ō
5GOKPCTő#ITKEWNVWTCNDKQICURNCPVUŌQRRQTVWPKVKGUHQT
FGXGNQROGPVKP2QNCPFŒ
5GOKPCTTQQO
D[VJGTWPYC[
Ō
5GOKPCTő/CTMGVQH2NCPV2TQVGEVKQP#IGPVUŌEWTTGPV
UKVWCVKQPCPFRGTURGEVKXGUŒ
5GOKPCTTQQO
D[VJGTWPYC[
Ō
2TGUUEQPHGTGPEGUWOOKPIWRVJGVJGFKVKQP
QH#)415*19
2TGUUQHſEG
Monday, 23 September 2013 (day for professionals)
6JGGZJKDKVKQPKUQRGPHTQOCOVQRO
XV Międzynarodowa Wystawa Rolnicza AGRO SHOW 2013
PROGRAM WYDARZEŃ
Podczas wystawy odbywają się pokazy maszyn na indywidualnych poletkach pokazowych.
Punkty konsultacyjne i doradcze znajdują się na stoiskach instytucji rządowych.
Piątek, 20 września 2013 r. (wystawa czynna dla zwiedzających w godz.: 9:00 – 17:00)
QFIQF\
#MTGF[VCELCF\KGPPKMCT\[
$KWTQRTCUQYG
Ō
-QPHGTGPELCRTCUQYCKPCWIWTWLæEC:8/KúF\[PCTQFQYæ
9[UVCYú#)415*19
$KWTQRTCUQYG
Ō
(KPCđMQPMWTUWœ/đQF[/GEJCPKMPC/GFCNŒ
*CNCUGOKPCT[LPC
RT\[RCUKGUVCTVQY[O
Ō
(KPCđ++GF[ELKMQPMWTUWœ/GEJCPKMPC/GFCNŒ
*CNCUGOKPCT[LPC
RT\[RCUKGUVCTVQY[O
Ō
2QFUWOQYCPKG:+GF[ELK1IÎNPQMTCLQYGIQ-QPMWTUW
œ$G\RKGE\PG)QURQFCTUVYQ4QNPGŒ
*CNCUGOKPCT[LPQDCPMKGVQYC
Ō
2QMC\OCU\[PYTKPIWPQYQħEKđCFQYCTMKKđCFQYCE\G
E\QđQYGQRT[UMKYCE\GVGEJPKMCFNCTQNPKEVYC
RTGE[\[LPGIQ
4+0)ŌRQNGRQMC\QYG
Ō
9TúE\GPKGPCITÎF\WF\KCđGO/KPKUVTC4QNPKEVYCK4Q\YQLW
9UKNCWTGCVQOMQPMWTUÎYœ/đQF[/GEJCPKMPC/GFCN
Œœ/GEJCPKMPC/GFCNŒKœ5GTYKUPC/GFCNŒ
*CNCUGOKPCT[LPC
RT\[RCUKGUVCTVQY[O
Ō
5RQVMCPKG\/KPKUVTGO4QNPKEVYCK4Q\YQLW9UK
*CNCUGOKPCT[LPC
RT\[RCUKGUVCTVQY[O
Sobota, 21 września 2013 r. (wystawa czynna dla zwiedzających w godz.: 9:00 – 17:00)
Ō
2QMC\OCU\[PYTKPIW
PQYQħEKđCFQYCTMKKđCFQYCE\GE\QđQYGQRT[UMKYCE\G
VGEJPKMCFNCTQNPKEVYCRTGE[\[LPGIQ
4+0)ŌRQNGRQMC\QYG
Ō
5GOKPCTKWOPVœ2TQITCO4Q\YQLW1DU\CTÎY9KGLUMKEJ
PCNCVCŌLCMQļTÎFđQYURCTEKCſPCPUQYGIQ\G
ħTQFMÎY7'Œ
*CNCUGOKPCT[LPC
RT\[RCUKGUVCTVQY[O
Ō
9TúE\GPKGPCITÎFYRNGDKUE[VCEJœ4QNPKM4QMWŒK
œ5WRGT5QđV[UŒ
JCNCUGOKPCT[LPQDCPMKGVQYC
Niedziela, 22 września 2013 r. (wystawa czynna dla zwiedzających w godz.: 9:00 – 17:00)
Ō
2QMC\OCU\[PYTKPIW
PQYQħEKđCFQYCTMKKđCFQYCE\GE\QđQYGQRT[UMKYCE\G
VGEJPKMCFNCTQNPKEVYCRTGE[\[LPGIQ
4+0)ŌRQNGRQMC\QYG
Ō
5GOKPCTKWOPVœ$KQIC\QYPKG4QNPKE\GŌU\CPUGTQ\YQLWY
2QNUEGŒ
JCNCUGOKPCT[LPC
RT\[RCUKGUVCTVQY[O
Ō
5GOKPCTKWOPVœ4[PGMĦTQFMÎY1EJTQP[4QħNKPŌUVCP
QDGEP[KRGTURGMV[Y[Œ
JCNCUGOKPCT[LPC
RT\[RCUKGUVCTVQY[O
Ō
-QPHGTGPELCRTCUQYCRQFUWOQYWLæEC:8GF[ELú#)41
5*19
$KWTQRTCUQYG
2onied\iađeM, 23 Yr\eħnia 2013 r (d\ieē dla profesLonalistÎY)
9[UVCYCE\[PPCYIQF\Ō
PLAN WYSTAWY
FLOOR PLAN OF
AGRO SHOW 2013
AGRO SHOW 2013
3
15
170
312
313
323
331
333
.2:$/6&<352'8.&-$0$6=<152/1,&=<&+,&=ĉĝ&,=$0,(11<&+
63Ïà.$-$:1$
*(2'L%2(5,*,29$11$
PROGRASS POLSKA Sp. z o.o.
$1'(5:$/'0$6=<1<52/1,&=(
$*520(7352'8.&-$0$6=<152/1,&=<&+720$6=670$7(/6.,
63$:(;6áDZRPLU3UyĪDQLQ
5%86à8*,,+$1'(/5(1$7$1,(62%6.$/$856(1
52/8%75$',1*6S]RR
3/$1735(666S]RR
$*(1&-$35202&-,52/1,&7:$,$*52%,=1(68$35$6S]RR
0,&+$/$.35=('6,ĉ%,2567:2352'8.&<-12+$1'/2:286à8*2:(
35=(0<6à2:<,167<78702725<=$&-,
$703
$*520,;352'8&(170$6=<152/1,&=<&+62%$ē6.$=2),$
%52.(56(5:,60$6=<1<%8'2:/$1(35=('6,ĉ%,2567:2
+$1'/2:286à8*2:(-$16850$
ARMASZ
,19(1725-2ē6.,-$1
87(&+0DV]\Q\L8U]ąG]HQLD7HFKQLF]QH1RUEHUW.RHQLJ
720$6=2/6=$.33+8
$*52&+à23(&.,6&
$*520$6=3DZHá1RZDN
+<'5$0(733+86S]RR
CLAYDON
$*520$3U]HVLĊELRUVWZR+DQGORZH6$Z3R]QDQLX
52/0(7$/3U]HGVLĊELRUVWZR3URGXNF\MQR+DQGORZH7HUHVD.XEDĔVND-DFHN
.XEDĔVNL6SM
'$/%2$6
$.3,/3U]HGVLĊELRUVWZR3URGXNF\MQR8VáXJRZR+DQGORZH
32/675$870$116S]RR
52/0$.23+873+(15<..2:$/6.,
0$6&+,2*$63$5'232/$1'6S]RR
$*52(.23:*U]HJRU]3LOFK
$*520,;3836S]RR
0,52/=DNáDG+DQGORZR8VáXJRZ\0LHF]\VáDZ0LFKDOVNL
:<5Ï%*$/$17(5,,=0(7$/8:$/7(56&+(,'6(59,&(
$0,6SyáND]RJUDQLF]RQąRGSRZLHG]LDOQRĞFLą6.$
/8386),50$+$1'/2:$6</:(67(5:,/.
7956S]RR
)$5075$'(3DZHá.U\MRP
.8%27$'(876&+/$1'*PE+6S]RR2GG]LDáZ3ROVFH
K+S POLSKA Sp. z o.o.
YARA POLAND Sp. z o.o.
=$.à$'<&+(0,&=1(6,$5.232/7$512%5=(*6S]RR
)26)25<*GDĔVNLH=DNáDG\1DZR]yZ)RVIRURZ\FK6S]RR
*583$$=27<6$
*583$$=27<=$.à$'<$=272:(.ĉ'=,(5=<16$
*583$$=27<=$.à$'<$=272:(38à$:<6$
*583$$=27<=$.à$'<&+(0,&=1(32/,&(6$
)26)$16$
0$5.(752/1,&=<0,1*(63=22
$*52&+(676S]RR
%(673(67=38+0ĝ:,ĉ726à$:6.$-ĝ:,ĉ726à$:6.,6S-
7(&+0276S]RR2SROH
$5.2335=('6,ĉ%,2567:263=22
*5((12.3/
ANWIL S.A.
352/$%33+86S]RR
/89(1$6$
%,2:25/'6S]RR
*583$$=27<=$.à$'<$=272:(.ĉ'=,(5=<16$
$*52%,=1(663M6XIDU]5XGQLFNL
*5((1/$1'7(&+12/2*,$(06S]RR
)/25$6S]RR
POLCALC Sp. z o.o.
KAZGOD Sp. z o.o.
$*(1&-$35202&-,52/1,&7:$,$*52%,=1(68$35$6S]RR
20
21
22
23
24
25
26
27
28
29
32
34
35
36
38
38
39
178
179
183
185
186
190
269
270
271
273
334
335
336
338
340
342
344
345
346
348
349
350
351
353
354
355
356
362
363
364
365
367
368
369
370
371
372
373
BNP PARIBAS LEASING SOLUTIONS
GRANO-SYSTEM ILONA KULETA
WOL-MET ROMAN WOLNY
INTER IMPORT-EXPORT Sp. z o.o.
HEIN Sp. z o.o.
OPALL-AGRI s.r.o.
PNEUSEJ
LUCAS.G
CELLI S.p.A.
AGROMECHANIKA
92/$173U]HGVLĊELRUVWZR3URGXNF\MQR+DQGORZR8VáXJRZH
'*UDERZVNL8*UDERZVND6F
),50$352'8.&<-1286à8*2:2+$1'/2:$0,&+$à
MICHALAK
LANDTECHNIK GUT RENZOW GMBH
=$0(7=$.à$'352'8.&<-1286à8*2:<5\V]DUG,
0DUFLQ=DELHOVF\6SM
PROKMAR S.C. MARZENA WASZKOWIAK, KRZYSZTOF
WASZKOWIAK
CHAPMANS AGRICULTURAL LTD
HERMON CZECH & MUZIA SP.J.
$3932/6.$'$187$0à2&(.%,(ĩ8ē6.$
POMAROL S.A.
PREMIUM TRADE Sp. z o.o.
AGENCJA PROMOCJI ROLNICTWA I AGROBIZNESU
"APRA" Sp. z o.o.
1'6*5=(*25=0,&+$à(.
SIEMENS FINANCE Sp. z o.o.
MASCAR SPA
62&,(7(35202',663Ïà.$$.&<-1$63Ïà'=,(/1,$
2''=,$à:32/6&(
67$/7(&+*U]HJRU]'REU]DĔVNL
$*52)$&725<35=('6,ĉ%,2567:2
PRODUKCYJNO-HANDLOWE
PICHON S.A.
3(5.2=35=('6,ĉ%,2567:2+$1'/2:286à8*2:(
Sp. z o.o.
BAGRAMET SP. Z O.O.
),50$.2à$6=(:6.,
7$/(;/-$:256.,,:63Ï/1,&<63Ïà.$-$:1$
OTOMOTO
:,/+(/0672//0$6&+,1(1)$%5,.*PE+
.$*52.U]\V]WRI3DQNRZVNL
.g&.(5/,1**PE+&R.*
$*527(&+%$5<&=.$à8.$6=%$5<&=.$
WIELTON S.A.
KORBANEK Sp. z o.o.
AMG Sp. z o.o.
DWUH[SUHVV
KVERNELAND GROUP POLSKA Sp. z o.o.
.8+10DV]\Q\5ROQLF]H6S]RR
JOHN DEERE POLSKA Sp. z o.o.
AGRIAFFAIRES.PL
BM KOBYLIN Sp. z o.o.
AGRARIUS Sp. z o.o.
%2*'$133+83LRWU%RJGDQRZLF]
GRUPA INCO S.A.
.23$/1,$62/,.à2'$:$63Ïà.$$.&<-1$
PIAST PASZE Sp. z o.o.
32/6,/%,235(3$5$7<63Ïà.$-$:1$
TASOMIX WYTWÓRNIA PASZ I KONCENTRATÓW
'2/)266SyáND-DZQD3LRWURZLF].URJXOVND
TROUW NUTRITION POLSKA AP. Z O.O.
FIRMA ROZALCZYK Sp. z o.o.
+2+%85*0,1(5$/)877(5*PE+
NEOROL Sp. z o.o.
&$5*,//32/$1'63=222''=,$à:.,6=.2:,(
DE HEUS Sp. z o.o.
SCHAUMANN POLSKA Sp. z o.o.
JOSERA POLSKA Sp. z o.o.
BLATTIN POLSKA SP. Z O.O.
6$1212:2&=(61(ĩ<:,(1,(=:,(5=Ą76S]RR
DLG AGRO FOOD SP. Z O.O.(WYSTAWCA:
$*5,7(&+1,&$381.7,1)250$&<-1<
KWS LOCHOW POLSKA Sp. z o.o.
KWS POLSKA Sp. z o.o.
AGENCJA NASIENNA Sp. z o.o.
'$1.2+2'2:/$52ĝ/,16S]RR]VZ&KRU\QL
+2'2:/$52ĝ/,1602/,&(6S]RR*UXSD,+$5
+2'2:/$52ĝ/,1675=(/&(6S]RR*UXSD,+$5
0$à232/6.$+2'2:/$52ĝ/,1+%36S]RR
3R]QDĔVND+RGRZOD5RĞOLQ6S]RR
CENTER PLAST Sp. z o.o.
SPÓJNIA HODOWLA I NASIENNICTWO OGRODNICZE Sp.
z o.o.
LANTMÄNNEN SW SEED Sp. z o.o.
UNIWERSYTET PRZYRODNICZY W POZNANIU
=$.à$''2ĝ:,$'&=$/1<2&(1<2'0,$1
ĝ5(0:Ï-7267:2
RAPOOL POLSKA SP. Z O.O.
AGROYOUMIS PL. Sp. z o.o.
HURTOWNIA OGRODNICZA BOGDAN KRÓLIK
PLANTICO - HODOWLA I NASIENNICTWO OGRODNICZE
ZIELONKI Sp. z o.o.
HZPC POLSKA Sp. z o.o.
'(7$50.86(.63Ïà.$-$:1$
EUROPLANT HANDEL ZIEMNIAKAMI Sp. z o.o.
AGROMECHANIKA
(85$/,66$$7(16S]RR2''=,$à:32/6&(
40
41
42
45
46
47
48
50
51
52
53
54
55
57
58
61
63
64
66
POLSKIE WYDAWNICTWO ROLNICZE Sp. z o.o.
FUCHS OIL CORPORATION (PL) Sp. z o.o.
KRAMP SP. Z O.O.
*5$1,73DUWV&]ĊĞFL=DPLHQQH6S]RR6SN
$*52-$16F
OTTO TH. MENKE POLSKA Sp. z o.o.
6:67$+/:(5.=(8*9(575,(%6*PE+
INDUSTRIEHOF SCHERENBOSTEL HEINRICH
52'(1%267(/*PE+
AGRO-RAMI PRZEDSIEBIORSTWO WIELOBRANZOWE
5$1,ĝ,:63Ï/1,&<6&
UNIROL PARTS SP. Z O.O. SP.K.
$*52&=ĉĝ&,33+8$1'5=(-.5$86
AGROLAND Sp. z o.o.
TUBES INTERNATIONAL Sp. z o.o.
PLATINUM OIL WIELKOPOLSKIE CENTRUM
DYSTRYBUCJI SP. Z O.O.
TEXA POLAND Sp. z o.o.
INTER CARS S.A.
HORTPRESS Sp. z o.o.
$*52/$=DNáDG+DQGORZR3URGXNF\MQ\=G]LVáDZ1LHJRZVNL
STANIMPEX MACIEJ PACKIEWICZ
BRANDI P.P.H.U. JACEK KARCZMARCZYK
72/0(7=$.à$'352'8.&<-1286à8*2:2+$1'/2WY PIOTR WAWRZYNIAK
=$.à$'0(&+$1,.,0$6=<1,85=Ą'=(ē52/1,&=<&+
6à$:20,5%,$5'=.,
%$571,.7(&+1,&=1(:<326$ĩ(1,(52/1,&7:$
%2*86à$:%$571,.
BONDIOLI & PAVESI Sp. z o.o.
00$70$5,$10,.2à$-&=$.$*527(&+12/2*<
ALBUZ BOTT
MAROLEX Sp. z o.o.
$*52027257DGHXV]0LFKDODN
KWAZAR CORPORATION Sp. z o.o.
=+8$5*23$:(à.$/,ē6.,
5(06=./,0&=$.6SM
%$57(6.235=('6,ĉ%,2567:2:,(/2%5$1ĩ2:(
%DUWáRPLHM6NRZURĔVNL
70 AQUA-ROL Sp. z o.o.
'2%52:2/6.,0$6=<1<52/1,&=(5$'26à$:
DOBROWOLSKI
$/752)3+-$186=:2ĩ1,$.
73 KNOTT Sp. z o.o.
74 BLYSS POLSKA Sp. z o.o.
75 ALFA USZCZELNIENIA TECHNICZNE
*2632'$5=3/7:Ï-3257$/52/1,&=<
%$1.%*ĩ%$1.*2632'$5.,ĩ<:12ĝ&,2:(-6$
.(66(167(&+1,.0,76<67(0*PE+&R.*
320/WG6SyáND]RJUDQLF]RQąRGSRZLHG]LDOQRĞFLą
192 AGRONOMIK POLSKA Sp. z o.o.
193 FARMTEX TOMASZ PAWLAK
026.,735=('6,ĉ%,2567:2352'8.&<-12
86à8*2:2+$1'/2:(
194 MESCOMP-OPRYSKIWACZE
7$'/(133+8ĝZLDWáD7DGHXV]
196 AGROPLAST
3520$5=DNáDG3URGXNFML0DV]\Q5ROQLF]\FK
$*520$;6&6WDQLVáDZ2VHN7RPDV]2VHN
6.27$5(.3URGXNFMD0DV]\Q5ROQLF]\FKL&]ĊĞFL-HU]\
6NRWDUHN
199 BAYWA AG
200 VOGELSANG Sp. z o.o.
201 BAUER GROUP POLSKA Sp. z o.o.
à8.20(7.5=<6=72)à86=&=<.
202 MILTOM-EKO SP. Z O.O.
203 KUJAWSKA FABRYKA MASZYN ROLNICZYCH Sp. z o.o.
204 FARMER Sp. z o.o.
+<'520$6=6ĉ&(56.,63Ïà.$-$:1$
35=('6,ĉ%,2567:2352'8.&<-12+$1'/2:(
6&+$508(//(5*(6(//6&+$)7PE+&R.*
206 METALINVEST Sp. z o.o.
207 FARESIN INDUSTRIES S.P.A.
:2352/35=('6,ĉ%,2567:2352'8.&<-1286à8*2-
:2+$1'/2:(-HU]\:RUHN
6:,0(5275(0%$à8.$6=
210 CMKS POLSKA Sp. z o.o.
725$/7HFKQLF]QR+DQGORZD2EVáXJD5ROQLFWZD(OĪELHWD
.UXSD
212 SIPMA S.A.
274 ROLTOP SP. Z O.O.
275 SAME DEUTZ - FAHR POLSKA Sp. z o.o.
$5$-35=('6,ĉ%,2567:2352'8.&<-12:'52ĩ(1,2WE SP. Z O.O.
(6-2767$1,6à$:-$12:6.,63Ïà.$.20$1'<72:$
276 EXPOM Sp. z o.o.
0(7$/7(&+=$.à$'0(&+$1,&=1<6S]RR
3202738363=22&KRMQD
35$&2:1,&=<2ĝ52'(.0$6=<12:<:$8*8672:,(
Sp. z o.o.
277 INTERHANDLER Sp. z o.o.
278 UNIA Sp. z o.o.
*5,00(/$1'0$6&+,1(1)$%5,.*PE+&R.*
280 HERBERT DAMMANN GMBH
280 RAIFFEISEN AGRO-TECHNIKA Sp. z o.o.
$/2,63g77,1*(50DVFKLQHQIDEULN*PE+
(.27521,&0DUHN-DQXV
/(&+/(5*PE+
281 MUELLER ELEKTRONIK GMBH
281 PESSL INSTRUMENTS GMBH
282 NEW HOLLAND
283 AGROTOP-KACZMAREK Sp. z o.o.
=$6à$:7666S]RR6SN
375 TOOLMEX TRUCK Sp. z o.o.
:,$'202ĝ&,52/1,&=(32/6.$
377 FARMER
377 FARMER.PL
*,(à'$52/1$3/
378 AGRO SERWIS
:,(/.232/6.,(672:$5=<6=(1,(62à7<6Ï:
*$=(7$62à(&.$
380 PLANTPRESS Sp. z o.o.
381 MURATOR S.A.
382 AGENCJA PROMOCJI ROLNICTWA I
AGROBIZNESU "APRA" Sp. z o.o.
383 HORTPRESS Sp. z o.o.
384 RAIFFEISEN-LEASING POLSKA S.A.
385 ORLEN GAZ Sp. z o.o.
6,7212:<7:Ï51,$6,7.5=<6=72)
NOWAKOWSKI
387 BUTTIMER POLSKA Sp. z o.o.
387 CIMBRIA HOUSE
0$*527(;3U]HGVLĊELRUVWZR3URGXNF\MQR
8VáXJRZH6S]RR
389 AGROSIL Sp. z o.o.
(8526,/266,53VUO
389 MS AGROTECH Sp. z o.o.
052/63Ïà.$=2*5$1,&=21Ą
2'32:,('=,$/12ĝ&,Ą63.
391 AGREMO Sp. z o.o.
52/0(7=DNáDG:\WZyUF]R8VáXJRZ\VF
=80(&=DNáDG8U]ąG]HĔ0HFKDQLF]Q\FK
(XJHQLXV]&LHĞOD
394 BIN Sp. z o.o.
.216,/35=('6,ĉ%,2567:22%6à8*,
ROLNICTWA
$*(1&-$1,(58&+202ĝ&,52/1<&+
396 AGENCJA RESTRUKTURYZACJI I
MODERNIZACJI ROLNICTWA
396 AGENCJA RYNKU ROLNEGO
396 KASA ROLNICZEGO UBEZPIECZENIA
632à(&=1(*22GG]LDá5HJLRQDOQ\Z3R]QDQLX
396 MINISTERSTWO ROLNICTWA I ROZWOJU WSI
*àÏ:1<,163(.725$735$&<::$56=$:,(
398 WALTER WATSON LTD
399 ELWA S.J.
:,(/.232/6.,2ĝ52'(.'25$'=7:$
ROLNICZEGO
401 BÜHLER POLSKA Sp. z o.o.
402 SALIDA Sp. z o.o.
'2=$*525$'26à$:5<%$&.,
'2=$0(&+0HFKDQLND0DV]\Q,8U]ąG]HĔ
5ROQLF]\FK'RQDW=DZLG]NL
%86&++2))7+*PE+&R
404 KREBECK STALLEINRICHTUNGEN UND
$33$5$7(%$8*PE+
404 PLOTTNIK AGROCONSULTING
$'1$5.2à2'=,(-&=<.'$1,(/
$*5,3$.6S]RR6SN
407 TORNUM POLSKA Sp. z o.o.
$*5$/(;LQĪ$OHNVDQGHU/XELĔVNL
409 P.P.U.H. AGOS
320.$/,6=33+L86S]RR
410 FEERUM S.A.
492 CONCORDIA UBEZPIECZENIA
493 TRUCK&VAN
781,1*35=('6,ĉ%,2567:2-2$11$
HALICKA
%52:1&R6SyáND]RR
496 KST KONSULTING Sp. z o.o.
497 WIELKOPOLSKIE WYDAWNICTWO ROLNICZE
Sp. z o.o.
498 PRO AGRICOLA SZP. Z O.O.
499 WYDAWNICTWO TRUCK AUTO KOMIS /
CZASOPISMO MOTOFARMER.PL
500 ELMARK-WYNAJEM Sp. z o.o.
'20$6=720$6=:$/,*Ï5$
502 TAMA POLSKA SP. Z O.O.
503 KLIMTOP CONTROLS POLSKA Sp. z o.o.
504 VRETEN AB
:,0$50DULXV]:LĞQLHZVNL
$*$73U]HGVLĊELRUVWZR:LHOREUDQĪRZH3LRWU
-DVLĔVNL
507 CENTRUM TECHNIKI ROLNICZEJ Sp. z o.o.
508 CENTER PLAST Sp. z o.o.
$0$1-$186=0à<1$5&=<.
%5$732/35=('6,ĉ%,2567:2+$1'/2:(
JERZY BRATKOWSKI
511 MARMA POLSKIE FOLIE
512 PLANTA Sp. z o.o.
513 AGRIMPEX SP. z o.o.
(5*%,(58ē)2/,(6S]RR
*8067$/6WDQLVáDZD/XELV]HZVND
$5,.21$*523U]HGVLĊELRUVWZR:LHOREUDQĪRZH
517 LOGIS Sp. z o.o.
'()$/,1*52836$3U]HGVLĊELRUVWZR
3URGXNF\MQR+DQGORZR8VáXJRZH
.586=(&=$.à$'86à8*2:2352'8.&<-1<
7(53/$676S]RR=DNáDG\3U]HWZyUVWZD
7ZRU]\Z6]WXF]Q\FK
62/$17&=(&+à&=(&+6SM
32/&$53U]HGVLĊELRUVWZR0RWRU\]DF\MQH6S]
o.o.
523 PORSCHE INTER AUTO POLSKA Sp. z o.o.SALON VOLKSWAGEN SAMOCHODY
8ĩ<7.2:(:68&+<0/(6,(
524 APH GROUP POLSKA Sp. z o.o.
524 OMNIVENT Sp. z o.o.
525 KSM TRADING Sp. z o.o.
526 WEREMCZUK FMR Sp. z o.o.
3529(*$6SM0:5Ï%/(:6.,0
à8.$6,(:,&=
:,(ĝ&,52/1,&=(
0$'2.6'DULXV]3U]HJDOLĔVNL
7(&+0(7$00=-8=:$63Ïà.$-$:1$
531 BIALPAK
$/,&-$=$.à$'+$1'/2:2352'8.&<-1286à8*2:<+(15<.*ĉ%$à$
533 FRISOMAT Sp. z o.o.
534 STILL POLSKA Sp. z o.o.
),50$12:$.6SM
$*520(+$1,.$GG
3,6(.9,7/,.53$1GRR
7(+126GRR=DOHF
680(5$0272563Ïà.$-$:1$
597 ENA LTD Sp z o.o.
12:$:,(ĝ(8523(-6.$
6.5$:0(7+<'5$8/,.$6,à2:$6S]RR6.
$*5$7(&+1,(.%9
+20%85*0$&+,1(+$1'(/%9
32/%272$*5,6S]RR
=8,'%(5*)5217/,1(6<67(06%9
925/$1',32/$1'6S]RR6SN
6=1$-'(5)+8(/ĩ%,(7$6=1$-'(5
,1'8675<',(6(/2,/6S]RR
,038/6/($6,1*32/6.$6S]RR
',(6(/&=ĉĝ&,&]ĊĞFLVLOQLNRZH
GRPDV]\QEXGRZODQ\FKLUROQLF]\FK
*;/32/6.$6S]RR
3$571(56<67(0663Ïà.$=22
.,1*63$1(19,5210(17$/6S]RR
(03/(;6S]RR
3527(&+1,.$
)257,67(&+12/2*<63=2263.
0,ĉ'=<1$52'2:(7$5*,32=1$ē6.,(6S]RR
$*527(&+1,.$%58'=:,(6à$:%58'=
'2/=$0(76S]RR
.20)257=DNáDG3URGXNF\MQR8VáXJRZRKDQGORZ\
.L-6&3U]HGVLĊELRUVWZR:LHOREUDQĪRZH
52/1,&7:235(&<=<-1($1'5=(-35=(3(56.,
$8723$576$
%5$70(7-$1,.63Ïà.$-$:1$
:<7:Ï51,$86=&=(/(.0253$.3DZHá-DZRUVNL
$*5,&2163=22
$*52%(5*5HQDWDL6WDQLVáDZ%HUJ6&
6720,/6$12.'<675<%8&-$6S]RR
=$.à$'1$35$:&=<0(&+$1,=$&-,52/1,&7:$
JAN KUCHARSKI
3521$53+8'$5,86=.$:.$
7(&+0276S]RR
=$.à$'<635=ĉ780(&+$1,&=1(*2856866S]RR
2,/&(17(56S]RR6SN
6)),/7(56S]RR
35(&<=<-1(52/1,&7:2&20
'$9'$187$$1'5=(-92*(/
'852)5$1&($*5,&2168/76S]RR
.5$0(5:(5.(*PE+
$*527,0+7RPDV],ZDV]NLHZLF]
',77$6(5,$(GPXQG3LHWU]DN
&6)32/6.$63=22
.20$76832/$1'6S]RR
(:3$0$6=<1<%8'2:/$1(6S]RR
)/,(*/$*5$57(&+1,.*PE+
$/,0$%,63U]HGVLĊELRUVWZR3URGXNF\MQR+DQGORZR8VáXJRZH6S]RR
7($02)$*5$6S]RR
92*(/12273ROVND6áDZRPLU/DQJQHU
0$1'$063=2235=('6,ĉ%,2567:2352'8.&<-12
+$1'/2:(
9%/($6,1*32/6.$6$
284 CASE IH
284 STEYR
$*&26S]RR
35=('6,ĉ%,2567:2520$12:6.,
&5<67$/75$.7256S]RR
0(7$/7(&+1,.6&
:(,'(0$1132/6.$
-26.,132/6.$6S]RR
5,(/$32/6.$6S]RR
291 MCHALE ENGINEERING LIMITED
0(7$/)$&+63=22
6$0$6=6S]RR
$*520$5.(735=('6,ĉ%,2567:2+$1'/2:((0/
6.5=<3&=$.6SM
0(352=(7.2ĝ&,$16$
$9$1732/6.$6S]RR
-81..$5,32/6.$6S]RR
0(382<
6(5$),138+
$.)/($6,1*32/6.$6$
=8372563=22
)25732/6S]RR
5(67$/=$.à$':<52%Ï:0(7$/2:<&+(/ĩ%,(7$5(0%,$6=
%,8527(&+1,&=12+$1'/2:(35202725PJULQĪ-DQ
.XUNLHZLF]
'5=(:,&=:\WZyUQLD6XV]DUĔ.5RNLFNL
*$632/6$
0(&32/686=$51,(
3('5277,32/6.$6S]RR
%$5%$7866S]RR
81,0(7$/63=22
&(0%5,76$
,17(5/(566S]RR
35=('6,ĉ%,2567:2:,(/2%5$1ĩ2:(%25<66&:$/'(0$5
.$&=0$5(.3$75<./$726
%$*32/6.$6S]RR
0,&+$à=38+.U]\V]WRI7DUJRĔVNL
$*520(7=3+86&
3$7&KRPXWRZ63-
6,/27(&+.20252:6.,63Ïà.$-$:1$
.$52/6S]RR
6
$
'
32/$1'6S]RR
$*5281,0$35=('6,ĉ%,2567:2:,(/2)81.&<-1(PJULQĪ
&H]DU\6]WXGHU
6,7$0(7:<7:Ï51,$6,71$35$:$0$6=<1&=<6=&=Ą&<&+
)$%5<.$:$*.$/,672+XEHUW*UXSD
)(502.$52/2:&=$5(.
:2/)6<67(06S]RR
.2%(;+$/(,:,$7<67$/2:(
1(;763Ïà.$-$:1$'2527$,3,275/,36&<
52%(/,76S]RR
)/25,$1&(175806$
3/$1'(.,5$6=<10$5&,1.2:$/6.,
67$/,03(;6S]RR
'$0,$1)LUPD+DQGORZR8VáXJRZD
2.1$$0$7,$1(7$/8':,&=$.
67$/0$&+0$&+2:6.,
86à8*,2*Ï/12%8'2:/$1(52%(57&,(6,(/6.,
$*52&203/(;
:<7:Ï51,$),/75Ï:3=/6ĉ'=,6=Ï:6$
+8352VSRO6UR
=$.à$'0(&+$1,&=1<352*5(66/HV]HN6DZLFNL
551 RICHEL SERRES DE FRANCE
'()5235=('6,ĉ%,2567:2:,(/2%5$1=2:(5REHUW']LXEHáD
:$/'*2/'6S]RR
+$1'(/$57<.8à$0,.216803&<-1<0,:,(6à$:
12:$.2:6.,
$%=$'$0=$&+$52:
*$/(5,$.6(16S]RR
67$&-$+2'2:/,,81$6,(1,(1,$=:,(5=Ą76S]RRZ
%\GJRV]F]\
%(/&+,0&5233527(&7,2132/$1'6S]RR
=2&21
$*52=$23$75=(1,(6SyáND]RR
%8'.27=$.à$'%8'2:<.27àÏ:0,526à$:ĝ/,:$
*5$62=HQRQ6RELHFNL
'823/$67$*
0(7$/(5*6S]RR6.$
(1(5*26<67(0=$.à$'.27/$56.,520$1*,(/1,$.
.21$53+86&
(.2+857$57853(1.$/$
6(.2.27à<&(175$/1(*22*5=(:$1,$
=$.à$'352'8.&<-12+$1'/2:<67$1,6à$:.5=$&=(.
)2.8633+85$'26à$:),%1(5:$/'(0$567$6=$.
,17(57(&+33+83LRWU-DQNRZVNL
111 TOTAL POLSKA Sp. z o.o.
$*527(&+1,.'$1,(/=$5ĉ%$
3U]HGVLĊELRUVWZR3URGXNF\MQR+DQGORZR
8VáXJRZH
113 PEWAG POLSKA Sp. z o.o.
114 PETROCONSULTING Sp. z o.o.
115 SPAREX POLSKA SP. Z O.O.
0(&+$1,.$0$6=<1,85=Ą'=(ē
ROLNICZYCH TOMASZ PINKOWSKI
$*(32:(56SM
118 EMMAROL SP. Z O.O.
119 ART-GUM Sp. z o.o.
6:,0(5275(0%$à8.$6=
121 STEELPRESS Sp. z o.o.
122 AXMANN JERZY CHRZANOWSKI
122 POLSKIE ZRZESZENIE PRODUCENTÓW
%<'à$0,ĉ61(*2
123 IOW SERVICE Sp. z o.o.
123 IOW TRADE Sp. z o.o.
*5$6'25).2à$32/6.$6S]RR
125 HANDLOPEX S.A.
/(*8033+$1'(/,6(5:,685=Ą'=(ē
WULKANIZACYJNYCH
127 JMK Sp. z o.o.
128 SOLIDEAL POLSKA S.A.
.$%$76SyáND-DZQD
129 ATK - RETREADS POLSKA Sp. z o.o.
%9%(&2
6&+8,7(0$.(50$&+,1(6%9
226 ATW S.A.
%2+1(1.$03$*
227 LP
227 TRINKER
%(587(;6S]RR
229 JANSSEN POLAND Sp. z o.o.
230 CAMARA POLONIA JESUS MANUEL CAMARA
PEREZ
231 HORTMASZ Sp. z o.o.
232 PZU S.A.
233 PTM TRADE-CENTRUM RUCHOMYCH
32'àÏ*DXWRU\]RZDQ\G\VWU\EXWRU67$6
&$5*2)/225+8())(50$11
234 AGRARSAM Sp. z o.o.
235 KELLFRI SP. Z O.O.
%,852'25$'&=2+$1'/2:(-$&(..5Ï/
237 EKO-INVEST SP. Z O.O.
3(7(5.5g*(5*PE+
75$,/(57(&+63Ïà.$=22
*5(*2,5(%(662132/6.$6S]RR
295 MANITOU POLSKA Sp. z o.o.
296 LELY EAST Sp. z o.o.
%(020272566S]RR
%=:%./($6,1*6$
297 ZETOR POLSKA Sp. z o.o.
%5$5'(76$55$1
%52&+$5'&216758&7(85
298 CARRE
298 CARRECARTEL / SILOFARMER POLSKA
298 CFCAI
298 DANGREVILLE
298 DENIS
298 EMILY
298 FRACOP Sp. z o.o.
298 HYDROKIT
298 PRIVE
5$%$8'
298 TOUT POUR LE GRAIN (TPLG)
8%,)5$1&(
$*5,)$&0$&+,1(5<%9
300 AGRINAVIA POLSKA Sp. z o.o.
300 HAGE POLSKA Sp. z o.o.
+$5',*0%+
300 KONGSKILDE-POLSKA Sp. z o.o.
300 VILOFOSS POLSKA Sp. z o.o.
%(7(%(*PE+
7+<(/2.(1%(5*32/6.$6S]RR
%,*'87&+0$163=22
(.252/63Ïà'=,(/&=(
35=('6,ĉ%,2567:2
436 TERRAEXIM-AGROIMPEX Sp. z o.o.
436 V.V.M TECHTRADE POLSKA Sp. z o.o.
437 WESSTRON - PRODUKT S.C.
052*2=,(:,&=/(:$1'2:6.$-$186=
LEWANDOWSKI
$*52%8'3:àXNDV]0DWF]DN
438 INOFAMA S.A.
439 HOG SLAT Sp. z o.o.
440 EFIPOL Sp. z o.o.
32/1(76S]RR,:63Ï/1,&<63Ïà.$
KOMANDYTOWA
442 AGENCJA PROMOCJI ROLNICTWA I
$*52%,=1(68$35$6S]RR
0,$5<,:$*,7RPDV].RJXW6SM
0$5$;55$-6SM
6:,0(5275(0%$à8.$6=
446 OMARV SRL
447 KINGSPAN INSULATION Sp. z o.o.
448 ASAT INTERNATIONAL Sp. z o.o.
449 PRECON POLSKA S. z o.o.
450 ACO FUNKI AS
451 RYU ARM POLSKA JADWIGA SZCZUREK
452 AGRIKOMP POLSKA Sp. z o.o.
452 ELTECO POLAND Sp. z o.o.
452 PIG-SIN IMPORT-EXPORT
=$.à$'ĝ/86$56.,*5(ē6-%ROHVáDZL
*UDĪ\QD*UHĔ
454 SG EQUIPMENT LEASING POLSKA SP. z o.o.
&=(.$à$6&0$5&,1&=(.$à$7(5(6$
&=(.$à$
)$%5<.$:$*%$/$16%DUEDUD=LyáNRZVND
GPSVSO
'$1%8''$1,(/3,$6(&.,352'8.&-$,
HANDEL MASZYNY ROLNICZE
574 IZOLACJE PLUIMERS Sp. z o.o.
.215$'3+.U]\V]WRI3U]HĨG]LHFNL
576 ROLKAP
577 EKOFLORA SIEWIELEC TADEUSZ
35=('6,ĉ%,2567:2(.2/2*,&=1(
$*52.20)2570DUHN0DOF]HZVNL
$*5,32/$GDP%U]ąNDáD
%=.*URXS6S]RR
(852%$**,1*652
$11$%85*(532/6.$6S]RR
0(5,780%$1.,&%6$
/,5$:\WZyUQLD3DV]6S]RR
584 NIJHUIS WATER POLSKA Sp. z o.o.
.$5&+(;0$&,(--(ĩ
586 TYWENT Sp.
587 P.H.U. TRANS STACHOWIAK
'(;:$/%,6338+'RURWD:DONLHZLF]
589 HF INVERTER POLSKA S.C.
590 GIZEX PHPU Sp. z o.o.
75$03--0LNXV]6S-
72.2$*5,DV
593 ENERGETYCZNE CENTRUM S.A.
6,$/:.,0%(5%.,0%(5+
.,0%(56SyáND-DZQD
%,**5((1(**
600 DAF AGRO - ANDO TECH Sp. z o.o.
$*52%,6:%RUOLN
602 KLAUS-PETER ZANDER Sp. z o.o.
*583$$=27<=$.à$'<&+(0,&=1(
32/,&(6$
604 SCHAEFFLER POLSKA Sp. z o.o.
605 S.C. TOMIT AGRI MACCHINE SRL
$(52$%
607 FILESAN NET AND SACK INDUSTRY
(8520$6=8VáXJL5ROQLF]H:RMFLHFK
:\FLV]NLHZLF]
609 AGRO-FARM PHU
610 MAZOWECKIE CENTRUM HODOWLI I
52=52'8=:,(5=Ą'6S]RR
611 ECOJURA Sp. z o.o.
-$*Ą6.$6SM
',81$63M3LRWU'UDELĔVNL-HU]\:\SRUNLHZLF]
$*0$)+80$&,(-.$ħ0,(5&=$.
6,0(1$63Ïà'=,(/1,$=3&+
52/0$6=32/35=('6,ĉ%,2567:2
+$1'/2:286à8*2:(
%8/0$&+63=22
%,1277232/6.$63=22
0272%86:Ą752%$$1'5($5&=<.63-
=$.à$'0(&+$1,=0Ï:1$3ĉ'2:<&+6&*DEU\MHOD
6]\GáRZVND5RPDQ7DĔVNL
$*52+$1'/(533+8à8.$6=:2ħ1,$.
*(532/63=22
$*520(;
6(5:,66./(3$/7(51$725Ï:,52=586=1,.Ï:
6WDQLVáDZ2VLĔVNL
$5(7(&=(6à$:./(-%8.
0(&+$1,.6&=$.à$'
86à8*2:2+$1'/2:<67$1,6à$:
=$5=(&.,-$1720$6=(:6.,
6=$5$),135=('6,ĉ%,2567:2
352'8.&<-12+$1'/2:286à8*2:(
720$6=6=5$),1
=$.à$'<*Ï51,&=20(7$/2:(=ĉ%,(&
:=ĉ%&863Ïà.$$.&<-1$
,1'8675$63=22
.$%(5*5=(*25=6&+(,1.(
6$87(5*PE+
&5(',7$*5,&2/(%$1.32/6.$6$
(8523(-6.,)81'86=/($6,1*2:<
63Ïà.$$.&<-1$
0$'$55(1$7$6&+0,'7
=à27(&.,6S]RR
$*52*583$%2ĩ(1$'5$%(.63Ïà.$
.20$1'<72:2$.&<-1$
:(6(0'07+$-'8.63Ïà.$-$:1$
9,5$*2352'8.76&-à8&=$.$à8&=$.
.,1*721<32/6.$
31(80$32/-$1.2:6&<63-
&(5027256S]RR
+<'527253U]HGVLĊELRUVWZR+\GUDXOLNL6LáRZHM
6$
+<'5235(66+<'5$8/,.$6,à2:$
%*32/$1'6S]RR
(1'5(6632/6.$6S]RR
(1(5*(7<.6(5:,66S]RR
52/08633+87(;3257,03257
0,(&=<6à$:6=<0.2:,$.
'20,;35=('6,ĉ%,2567:2:,(/2%5$1ĩ2:(
720$6='2%5<&+à23
,7$/&206S]RR
$*(1&-$35202&-,52/1,&7:$,
$*52%,=1(68$35$6S]RR
à8&=$.0$6=<1<52/1,&=(6WDQLVáDZàXF]DN
0$.,7$63=22
+8649$51$32/$1'63=22
+<'520(7$/720$6=.2:$/(:6.,
$8727(&+33+852%(571,(6.Ï56.,
67$/0(&+%RJXPLá.VLĊĪDNRZVNL
6$/(6352'8&7,21&2168/7,1*6S]RR
=%36.(03)6S]RR
52/7(&+&212:6S]RR
8$%:(67(51)$%5,&$7,216
.2%=$5(1.26S]RR
52/75$163+83:$/'(0$5.2%</,ē6.,
1$-%$5)+
5(0352'(;6S]RR
$1'5($667,+/63Ïà.$=22
'8$/6\VWHP
,*$0(70HFKDQLND0DV]\QL8U]ąG]HĔ5ROQLF]\FK
-DQXV].RPRURZVNL
17,1'8675<63=22
/8':,*%(5*0$11*PE+0DVFKLQHQIDEULN
+(15<.)LUPD+HQU\N%DW\UD
)(/,.61$*/$.3U]HGVLĊELRUVWZR3URGXNF\MQR
8VáXJRZR+DQGORZH
=$.à$'0(7$/2:<$*520$6=
*586=&=(:6.,-$186=
%20(73U]HGVLĊELRUVWZR3URGXNF\MQR+DQGORZR
8VáXJRZH$QGU]HM6LĔF]XN
%85<0$6=<1<52/1,&=(:2-&,(&+%85<
)$5075$&75$&7256(8523(6S]RR
-$50(76SyáND-DZQD'DULXV]6LĔF]XN7RPDV]
6WHUQLFNL
.0.$*52'.DĨPLHUF]DN&0ąGU\0
.DĨPLHUF]DN6SM
&/$$632/6.$6S]RR
$*5,202'(51,=(0('(/6.(6/8=%<VUR
)$50(7$6
',(&,6UO
67257,6S$
$0$=21(1:(5.(+'5(<(5*PE+&R.*
7(&+.203U]HP\VáDZ/DVNRZVNL
$*5,6(0,17(51$7,21$/6$6
+256&+0$6&+,1(1*0%+
/(0.(132/6.$6S]RR
9b'(567$'6S]RR
%('1$5)07VUR
0(5/232/6.$6S]RR
52/67$/3DZáRZVNL3DZáRZVNL-DQXV]
352962/$5
*(0(.25DIDá5RJRZVNL
3,7(516S]RR
),50$:::,(6à$::à$=$à(.
%,2*$=7(&+6S]RR
),50$86à8*2:2+$1'/2:$'$5,86=
:,&+72:6.,
)2*$*527(&+1,.32/$1'6S]RR
6XQGV$OID0HPEHURI,%)*URXS
63Ïà'=,(/1,$,1:(67<&-,,%8'2:1,&7:$:
à2:,&=8
=$.à$'<0(7$/2:(:35=<6,(.$&+63=
22
*583$&%35()$%5<.$&-$6S]RR
$9,7$6à$:20,5587=
$;0$11-(5=<&+5=$12:6.,
,1:(67$*527(&+1,&=1$2%6à8*$
52/1,&7:$:2-&,(&+6,(ē.2
'$1%5(',17(51$7,21$/32/$1'5$)$à
./(3&=<ē6.,
0$;<*(133+8(;3257,032576</:,$
'8'(.
)$5087,/+6=$.à$'52/1,&=235=(0<6à2
:<63Ïà.$$.&<-1$
,16()$506S]RR
%0.2%</,1=$.à$'<0,ĉ61(6S]RR
6(5:,6&(175806S]RR
35=('6,ĉ%,2567:2:,(/2%5$1ĩ2:(
*(<(5+26$-$6S]RR=DNáDG\*XPRZHZ
3DUW\QL
-)&32/6.$6S]RR
26,32/$1')22':25.66S]RR
$/)$3$1(/,19(6763=22
$17,1866S]RR
&:'6S]RR
(5,&+67$//.$0332/6.$6S]RR
*$0$3+86=(3,(72:6&<63-
3(//2163=22
5-52/,03(;3U]HGVLĊELRUVWZR
3URGXNF\MQR+DQGORZH
+2'2:&$6S]RR
52/$1'),50$352'8.&-$+$1'(/86à8*,
5\V]DUG'UąJ
/,%(5263=22
$-'$56S]RR
*(1(8%HDWD-HUF]\ĔVND
Alfabetyczny spis wystawców
Alphabetical list of exhibitors
#lfabetyE\ny spis YystaYEÎY
Alphabetical list of Exhibitors
strona Nazwa firmy
2
2
2
2
2
2
2
3
3
3
4
4
4
4
4
5
5
5
5
5
6
6
6
6
7
7
7
7
8
8
8
8
8
8
9
44TUNING - PRZEDSIĘBIORSTWO 44 JOANNA HALICKA. . . . . . . .
ABZ ADAM ZACHAROW . . . . . . . . . . . . . . . . . . . . . . . . . .
ACO FUNKI AS. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ADEL ELEKTRONIKA DLA ROLNICTWA . . . . . . . . . . . . . . . . .
ADNAR KOŁODZIEJCZYK DANIEL . . . . . . . . . . . . . . . . . . . .
AERO AB . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGAT Przedsiębiorstwo Wielobranżowe Piotr Jasiński . . . . . . . . . .
AGCO Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGENCJA NASIENNA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . .
AGENCJA NIERUCHOMOŚCI ROLNYCH . . . . . . . . . . . . . . . .
AGENCJA PROMOCJI ROLNICTWA I AGROBIZNESU „APRA” Sp. z o.o.
AGENCJA RESTRUKTURYZACJI I MODERNIZACJI ROLNICTWA . . . .
AGENCJA RYNKU ROLNEGO . . . . . . . . . . . . . . . . . . . . . . .
AGE-POWER Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGMA F.H.U. MACIEJ KAŹMIERCZAK. . . . . . . . . . . . . . . . . . .
AGRALEX inż.. Aleksander Lubiński . . . . . . . . . . . . . . . . . . . .
AGRARIUS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGRARSAM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGRATECHNIEK B.V. . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGREMO Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGRI CON SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGRIAFFAIRES.PL . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGRICO POLSKA SP. Z O.O.. . . . . . . . . . . . . . . . . . . . . . . .
AGRIFAC MACHINERY B.V. . . . . . . . . . . . . . . . . . . . . . . . .
AGRIKOMP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . .
AGRIMPEX SP. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGRINAVIA POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . .
AGRIO MODERNI ZEMEDELSKE SLUZBY s.r.o. . . . . . . . . . . . . .
AGRIPAK Sp. z o.o. Sp.k. . . . . . . . . . . . . . . . . . . . . . . . . .
AGRIPOL Adam Brząkała . . . . . . . . . . . . . . . . . . . . . . . . .
AGRISEM INTERNATIONAL S.A.S. . . . . . . . . . . . . . . . . . . . .
AGRO MET Z.P.H.U. S.C. . . . . . . . . . . . . . . . . . . . . . . . . .
AGRO SERWIS. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGRO ZAOPATRZENIE Spółka z o.o. . . . . . . . . . . . . . . . . . . .
AGROBERG Renata i Stanisław Berg S.C. . . . . . . . . . . . . . . . .
AGRO-BIS W.Borlik . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGRO-BIZNES SP.j. Sufarz-Rudnicki . . . . . . . . . . . . . . . . . . .
AGROBUD P.W. Łukasz Matczak . . . . . . . . . . . . . . . . . . . . .
sektor, nr stoiska/hala, nr drogi
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
. . . . . . . . . . . . . C 494
. . . . . . . . . . . . . D 555
. . . . . . . . . . . . . E 450
. . . . . . . . . . . C hala 31
. . . . . . . . . . . . . C 405
. . . . . . . . . . . . . E 606
. . . . . . . . . . . . . C 506
. . . . . . . . . . . . . D 285
. . . . . . . . . . . . . B 356
. . . . . . . . . . . . . C 396
A9,B39,F239,A332,C382,E442
. . . . . . . . . . . . . . C 396
. . . . . . . . . . . . . . C 396
. . . . . . . . . . . . . . E 117
. . . . . . . . . . . . . . F 134
. . . . . . . . . . . . . . C 408
. . . . . . . . . . . . . . B 336
. . . . . . . . . . . . . . E 234
. . . . . . . . . . . . . . D 79
. . . . . . . . . . . . . . C 391
. . . . . . . . . . . . . . D 100
. . . . . . . . . . . . . . B 334
. . . . . . . . . . . . .C hala 7
. . . . . . . . . . . . . . E 299
. . . . . . . . . . . . . . E 452
. . . . . . . . . . . . . . C 513
. . . . . . . . . . . . . . E 300
. . . . . . . . . . . . . . F 303
. . . . . . . . . . . . . . C 406
. . . . . . . . . . . . . . E 579
. . . . . . . . . . . . . . F 306
. . . . . . . . . . . . . . D 424
. . . . . . . . . . . . . . C 378
. . . . . . . . . . . . . . D 560
. . . . . . . . . . . . . . D 101
. . . . . . . . . . . . . . E 601
. . . . . . . . . . . . . . A 328
. . . . . . . . . . . . . . E 438
strona Nazwa firmy
9
9
9
9
9
9
9
10
10
10
10
10
10
11
11
11
11
11
11
12
12
12
12
12
13
13
13
13
13
13
14
14
14
14
14
14
15
15
15
15
15
15
16
16
16
16
16
17
17
17
17
17
18
18
18
18
AGROCHEST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGROCHŁOPECKI S.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGROCOMPLEX . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGRO-CZĘŚCI P.P.H.U. ANDRZEJ KRAUS . . . . . . . . . . . . . . . . . . . . . . . .
AGRO-EKO P.W. Grzegorz Pilch . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Agro-Expo . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGRO-FACTORY PRZEDSIĘBIORSTWO PRODUKCYJNO-HANDLOWE . . . . . . . .
AGRO-FARM PHU . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGROGRUPA BOŻENA DRABEK SPÓŁKA KOMANDYTOWO-AKCYJNA . . . . . . . .
AGROHANDLER P.P.H.U. ŁUKASZ WOŹNIAK . . . . . . . . . . . . . . . . . . . . . . .
AGRO-JAN S.c. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGROKOMFORT, Marek Malczewski . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGROLA Zakład Handlowo-Produkcyjny Zdzisław Niegowski . . . . . . . . . . . . . .
AGROLAND Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGROMA Przesiębiorstwo Handlowe S.A. w Poznaniu . . . . . . . . . . . . . . . . . .
AGROMARKET PRZEDSIĘBIORSTWO HANDLOWE E.M.L. SKRZYPCZAK Sp.j. . . . .
AGRO-MASZ Paweł Nowak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGROMAX S.C. Stanisław Osek, Tomasz Osek. . . . . . . . . . . . . . . . . . . . . .
AGROMECHANIKA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGROMEHANIKA d.d. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGROMET PRODUKCJA MASZYN ROLNICZYCH TOMASZ ST. MATELSKI . . . . . . .
AGROMEX . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGRO-MIX PRODUCENT MASZYN ROLNICZYCH SOBAŃSKA ZOFIA . . . . . . . . .
AGROMIX PUP Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGROMOTOR Tadeusz Michalak . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGRONOMIK POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGROPLAST . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGRO-RAMI PRZEDSIEBIORSTWO WIELOBRANZOWE RANIŚ I WSPÓLNICY S.C. . .
AGROSIL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGROTECH BARYCZKA ŁUKASZ BARYCZKA . . . . . . . . . . . . . . . . . . . . . .
AGROTECHNIKA - PORADNIK ROLNIKA . . . . . . . . . . . . . . . . . . . . . . . . .
AGROTECHNIKA-BRUDZ WIESŁAW BRUDZ . . . . . . . . . . . . . . . . . . . . . . .
AGROTECHNIK-DANIEL ZARĘBA Przedsiębiorstwo Produkcyjno Handlowo Usługowe
AGROTIMH Tomasz Iwaszkiewicz . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGROTOP-KACZMAREK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGROTRADE GRZEGORZ OSTROWSKI . . . . . . . . . . . . . . . . . . . . . . . . .
AGROUNIMA PRZEDSIĘBIORSTWO WIELOFUNKCYJNE mgr inż.. Cezary Sztuder . .
AGROYOUMIS PL. Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AJDAR Sp. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AKF LEASING POLSKA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AKPIL Przedsiębiorstwo Produkcyjno Usługowo Handlowe . . . . . . . . . . . . . . .
AKTUALNOŚCI WYDAWNICTWO TARGOWE MAŁGORZATA LAMENTA-PRZYBYLSKA.
ALBUZ BOTT. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ALFA USZCZELNIENIA TECHNICZNE . . . . . . . . . . . . . . . . . . . . . . . . . .
ALFAPANEL INVEST SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ALICJA ZAKŁAD HANDLOWO-PRODUKCYJNO-USŁUGOWY HENRYK GĘBAŁA . . . .
A-LIMA-BIS Przedsiębiorstwo Produkcyjno-Handlowo-Usługowe Sp. z o.o. . . . . . .
ALOIS PÖTTINGER Maschinenfabrik GmbH . . . . . . . . . . . . . . . . . . . . . . .
ALTRO FPH JANUSZ WOŻNIAK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AMA (SHANGHAI) TRADING Co. Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . .
AMAN JANUSZ MŁYNARCZYK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . .
AMG Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AMI Spółka z ograniczoną odpowiedzialnością S.K.A. . . . . . . . . . . . . . . . . . .
ANDERWALD MASZYNY ROLNICZE . . . . . . . . . . . . . . . . . . . . . . . . . . .
ANDREAS STIHL SPÓŁKA Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ANNABURGER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ANTINUS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ANWIL S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
sektor, nr stoiska/hala
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
. . . . A 318
. . . . .A 19
. . . . D 547
. . . . C 49
. . . . A 263
. . . . E 602
. . . . B 182
. . . . E 609
. . . . F 154
. . . . F 141
. . . . C 44
. . . . E 578
. . . . C 56
. . . . C 50
. . . . A 171
. . . . D 293
. . . . A 168
. . . . C 197
B B29, B373
. . . . C 595
. . . . . A5
. . . . F 143
. . . . .A 13
. . . . A 263
. . . . C 65
. . . . C 192
. . . . C 196
. . . . C 47
. . . . C 389
. . . . B 190
C C55,C383
. . . . D 92
. . . . E 112
. . . . D 215
. . . . C 283
. . C hala 36
. . . . D 429
. . . . B 368
. . . . F 490
. . . . D 411
. . . . A 174
. . .C hala 2
. . . . C 63
. . . . C 75
. . . . F 479
. . . . C 532
. . . . D 221
. . . . C 281
. . . . C 72
. . C hala 37
. . . . C 509
. . . . F 305
. . . . B 270
. . . . A 264
. . . . . A4
. . . . F 254
. . . . E 581
. . . . F 480
. . . . A 323
Alfabetyczny spis wystawców
Alphabetical list of exhibitors
strona Nazwa firmy
18
18
18
19
19
19
19
19
19
20
20
20
20
20
21
21
21
21
22
22
22
22
22
22
23
23
23
23
23
23
23
24
24
24
24
24
25
25
25
25
25
25
26
26
26
26
26
26
27
27
27
27
27
27
27
27
APH GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . .
APV POLSKA DANUTA MŁOCEK-BIEŻUŃSKA . . . . . . . . . . . . . . . . . .
AQUA-ROL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ARAJ PRZEDSIĘBIORSTWO PRODUKCYJNO-WDROŻENIOWE SP. Z O.O. . . .
ARETE CZESŁAW KLEJBUK. . . . . . . . . . . . . . . . . . . . . . . . . . . .
ARIKON-AGRO Przedsiębiorstwo Wielobranżowe . . . . . . . . . . . . . . . .
ARKOP PRZEDSIĘBIORSTWO SP. Z O.O.. . . . . . . . . . . . . . . . . . . . .
ARKUS WĘŻE HYDRAULICZNE, URZĄDZENIA LAKIERNICZE . . . . . . . . .
ARMASZ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ART-GUM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ASAT INTERNATIONAL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . .
ATK - RETREADS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . .
ATMP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
atr express . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ATW S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AUTOPART S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AUTO-TECH PPHU ROBERT NIESKÓRSKI . . . . . . . . . . . . . . . . . . . .
AVANT POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AVITA SŁAWOMIR RUTZ. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AXMANN JERZY CHRZANOWSKI . . . . . . . . . . . . . . . . . . . . . . . . .
BAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BAGRAMET SP. Z O.O.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BANK BGŻ (BANK GOSPODARKI ŻYWNOŚCIOWEJ S.A.) . . . . . . . . . . .
BARBATUS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BARGAM S.p.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BARTESKO PRZEDSIĘBIORSTWO WIELOBRANŻOWE. Bartłomiej Skowroński
BARTNIK TECHNICZNE WYPOSAŻENIE ROLNICTWA BOGUSŁAW BARTNIK .
BAUER GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . .
BAYWA AG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BEDNAR FMT s.r.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BELCHIM CROP PROTECTION POLAND Sp. z o.o. . . . . . . . . . . . . . . .
BEMO MOTORS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BERLING S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BERUTEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BEST-PEST Z.P.U.H. M, ŚWIĘTOSŁAWSKA, J. ŚWIĘTOSŁAWSKI Sp. J.. . . . .
BETEBE GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BEZALIN S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BG POLAND Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BIALPAK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BIG DUTCHMAN SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BIG GREEN EGG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BIN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BINOTTO POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . .
BIOGAZ-TECH Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BIOPROJECT s.r.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BIO-WORLD Sp. z o o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BITZER WIEGETECHNIK GmbH . . . . . . . . . . . . . . . . . . . . . . . . .
BIURO DORADCZO-HANDLOWE JACEK KRÓL . . . . . . . . . . . . . . . . .
BIURO TECHNICZNO-HANDLOWE PROMOTOR mgr inż.. Jan Kurkiewicz . . .
BLATTIN POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . .
BLYSS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BM KOBYLIN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BM KOBYLIN ZAKŁADY MIĘSNE Sp. z o.o. . . . . . . . . . . . . . . . . . . . .
BNP PARIBAS LEASING SOLUTIONS. . . . . . . . . . . . . . . . . . . . . . .
BOGDAN PPHU Piotr Bogdanowicz. . . . . . . . . . . . . . . . . . . . . . . .
BOHNENKAMP AG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BOMET Przedsiębiorstwo Produkcyjno Handlowo Usługowe Andrzej Sińczuk .
BONDIOLI & PAVESI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . .
BORGA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
sektor, nr stoiska/hala
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
. . . C 524
. . . .B 37
. . . C 70
. . . C 276
. . . F 145
. . . C 516
. . . A 321
. C hala 32
. . . .A 15
. . . E 119
. . . E 448
. . . E 129
. . . .A 12
. . . B 270
. . . E 226
. . . D 97
. . . F 244
. . . D 294
. . . F 468
E122,F469
. . . D 422
. . . B 185
. . . C 77
. . . D 418
. . . A 267
. . . C 69
. . . C 60
. . . C 201
. . . C 199
. . . F 310
. . . D 558
. . . E 297
. C hala 20
. . . E 228
. . . A 319
. . . E 433
. C hala 25
. . . F 162
. . . C 531
. . . E 434
. . . E 598
. . . C 394
. . . F 138
. . . F 461
. C hala 40
. . . A 326
. C hala 27
. . . E 236
. . . D 414
. . . B 351
. . . C 74
. . . B 335
. . . F 474
. . . .B 20
. . . B 337
. . . E 227
. . . F 301
. . . C 61
. C hala 23
strona Nazwa firmy
28
28
28
28
28
28
28
29
29
29
29
30
30
30
30
30
30
30
30
31
31
31
31
32
32
32
32
32
33
33
33
33
33
33
33
34
34
34
34
34
34
34
35
35
35
35
35
35
35
35
36
36
sektor, nr stoiska/hala
BRANDI P.P.H.U. JACEK KARCZMARCZYK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C 58
BRARD ET SARRAN . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 298
BRAT-MET JANIK SPÓŁKA JAWNA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . D 98
BRATPOL PRZEDSIĘBIORSTWO HANDLOWE JERZY BRATKOWSKI . . . . . . . . . . . . . . . . . . . . . . . C 510
BROCHARD CONSTRUCTEUR . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 298
BROKER SERWIS MASZYNY BUDOWLANE PRZEDSIĘBIORSTWO HANDLOWO-USŁUGOWE JAN SURMA . . .A 14
BROWN & Co Spółka z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C 495
BUD-KOT ZAKŁAD BUDOWY KOTŁÓW MIROSŁAW ŚLIWA . . . . . . . . . . . . . . . . . . . . . . . . . . . . D 561
BÜHLER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C 401
BULMACH SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F 137
BURY MASZYNY ROLNICZE - WOJCIECH BURY. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F 301
BUSCHHOFF TH. GmbH & Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C 404
BUTTIMER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C 387
BV BECO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 130
BZ WBK LEASING S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 297
BZK Group Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 580
CAMARA POLONIA JESUS MANUEL CAMARA PEREZ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 230
CARGILL POLAND SP. Z O.O. ODDZIAŁ W KISZKOWIE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . B 347
CARRE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 298
CARRECARTEL / SILOFARMER POLSKA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 298
CASE IH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . D 284
CELLI S.p.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .B 28
CEMBRIT S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . D 420
CENTER PLAST Sp. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . B362, C508
CENTRUM TECHNIKI ROLNICZEJ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C 507
CER MOTOR Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F 159
CFCAI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 298
CHAPMANS AGRICULTURAL LTD. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .B 35
CIMBRIA HOUSE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C 387
CLAAS POLSKA Sp. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F 302
CLAYDON . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . A 170
CMKS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C 210
CONCORDIA UBEZPIECZENIA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C 492
CREDIT AGRICOLE BANK POLSKA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F 151
CRYSTAL TRAKTOR Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . D 287
CSF POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . D 217
CWD Sp. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F 481
CZEKAŁA S.C. MARCIN CZEKAŁA & TERESA CZEKAŁA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 455
DAF AGRO - ANDO TECH Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 600
DAL-BO A/S . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . A 173
DAMIAN Firma Handlowo-Usługowa . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . D 543
DANBRED INTERNATIONAL POLAND RAFAŁ KLEPCZYŃSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . F 471
DANBUD DANIEL PIASECKI PRODUKCJA I HANDEL MASZYNY ROLNICZE . . . . . . . . . . . . . . . . . . . E 573
DANGREVILLE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 298
DANKO HODOWLA ROŚLIN Sp. z o.o. z/s w Choryni . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . B 357
DAV DANUTA ANDRZEJ VOGEL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . D 110
DE HEUS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . B 348
DEFALIN GROUP S.A. Przedsiębiorstwo Produkcyjno Handlowo Usługowe . . . . . . . . . . . . . . . . . . . C 518
DEFRO PRZEDSIĘBIORSTWO WIELOBRANZOWE Robert Dziubeła . . . . . . . . . . . . . . . . . . . . . . . D 552
DENIS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 298
DETAR M.KUSEK SPÓŁKA JAWNA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . B 372
DEXWAL BIS PPUH Dorota Walkiewicz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 588
DIECI S.r.l. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F 304
DIESEL CZĘŚCI Części silnikowe do maszyn budowlanych i rolniczych . . . . . . . . . . . . . . . . . . . . . D 84
DITTA SERIA Edmund Pietrzak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . D 216
DIUNA SP.j. Piotr Drabiński, Jerzy Wyporkiewicz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F 133
DLG AGRO FOOD SP. Z O.O.(WYSTAWCA: AGRITECHNICA-PUNKT INFORMACYJNY) . . . . . . . . . . . . . B 353
dmps.pl. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 572
DOBROWOLSKI MASZYNY ROLNICZE RADOSŁAW DOBROWOLSKI. . . . . . . . . . . . . . . . . . . . . . . C 71
Alfabetyczny spis wystawców
Alphabetical list of exhibitors
strona Nazwa firmy
36
36
36
36
37
37
37
37
37
38
38
38
38
38
38
38
39
39
39
39
39
39
39
39
40
40
40
40
40
40
40
41
41
41
41
41
42
42
42
42
42
42
42
43
43
43
43
43
DOLFOS Spółka Jawna Piotrowicz, Krogulska . . . . . . . . . . . . . . . . . . . . . . . .
DOLOMIT Kopalnia „Ząbkowice” Przedsiębiorstwo Produkcyjno-Usługowo-Handlowe S.A.
DOLZAMET Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
DOMASZ TOMASZ WALIGÓRA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
DOMIX PRZEDSIĘBIORSTWO WIELOBRANŻOWE TOMASZ DOBRYCHŁOP . . . . . . . .
DOZAGRO RADOSŁAW RYBACKI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
DOZAMECH Mechanika Maszyn I Urządzeń Rolniczych Donat Zawidzki . . . . . . . . . .
DRZEWICZ Wytwórnia Suszarń K. Rokicki . . . . . . . . . . . . . . . . . . . . . . . . . .
DUAL System . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
DUO PLAST AG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
DURO-FRANCE / AGRI-CONSULT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . .
ECOJURA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
EFIPOL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
EKOFLORA SIEWIELEC TADEUSZ PRZEDSIĘBIORSTWO EKOLOGICZNE . . . . . . . . .
EKO-HURT ARTUR PENKALA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
EKO-INVEST SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
EKO-ROL SPÓŁDZIELCZE PRZEDSIĘBIORSTWO . . . . . . . . . . . . . . . . . . . . . .
EKOTRONIC Marek Janus . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ELMARK-WYNAJEM Sp. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ELTECO POLAND Sp. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ELWA S.J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
EMILY. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
EMMAROL SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
EMPLEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ENA LTD Sp z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ENDRESS-POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ENERGETYCZNE CENTRUM S.A.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ENERGETYK-SERWIS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ENERGO-SYSTEM ZAKŁAD KOTLARSKI ROMAN GIELNIAK . . . . . . . . . . . . . . . .
ERG BIERUŃ-FOLIE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ERICH STALLKAMP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ESJOT STANISŁAW JANOWSKI SPÓŁKA KOMANDYTOWA . . . . . . . . . . . . . . . . .
EURALIS SAATEN Sp. z o.o. ODDZIAŁ W POLSCE. . . . . . . . . . . . . . . . . . . . . .
EURO BAGGING S.R.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
EURO MASZ Usługi Rolnicze Wojciech Wyciszkiewicz . . . . . . . . . . . . . . . . . . .
EUROAGRICOLA ANDRES . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
EUROPEJSKI FUNDUSZ LEASINGOWY SPÓŁKA AKCYJNA. . . . . . . . . . . . . . . . .
EUROPLANT HANDEL ZIEMNIAKAMI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . .
EUROSILOS SIRP s.r.l.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
EWPA-MASZYNY BUDOWLANE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . .
EXPOM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
FABRYKA WAG BALANS Barbara Ziółkowska . . . . . . . . . . . . . . . . . . . . . . . .
FABRYKA WAG KALISTO Hubert Grupa . . . . . . . . . . . . . . . . . . . . . . . . . . .
FARESIN INDUSTRIES S.P.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
FARMER . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
FARMER Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
FARMER.PL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
FARMET A.S.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
FARMTEX TOMASZ PAWLAK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
FARMTRAC TRACTORS EUROPE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . .
FARMTRADE Paweł Kryjom . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
FARMUTIL HS ZAKŁAD ROLNICZO-PRZEMYSŁOWY SPÓŁKA AKCYJNA . . . . . . . . . .
FEERUM S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
FELIKS NAGLAK Przedsiębiorstwo Produkcyjno Usługowo Handlowe . . . . . . . . . . .
FERMO KAROL OWCZAREK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
FILESAN NET AND SACK INDUSTRY . . . . . . . . . . . . . . . . . . . . . . . . . . . .
FIRMA KOŁASZEWSKI. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
FIRMA NOWAK Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
FIRMA PRODUKCYJNO USŁUGOWO HANDLOWA MICHAŁ MICHALAK . . . . . . . . . .
sektor, nr stoiska/hala
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
. . . B 343
. C hala 13
. . . D 93
. . . C 501
. . . F 166
. . . C 403
. . . C 403
. . . D 415
. . . F 255
. . . D 563
. . . D 213
. . . E 611
. . . E 440
. . . E 577
. . . D 567
. . . E 237
. . . E 435
. . . C 281
. . . C 500
. . . E 452
. . . C 399
. . . E 298
. . . E 118
. . . D 88
. . . C 597
. . . F 163
. . . E 593
. . . F 164
. . . D 565
. . . C 514
. . . F 482
. . . C 276
. . . B 374
. . . E 580
. . . E 608
. C hala 29
. . . F 151
. . . B 372
. . . C 389
. . . D 219
. . . C 276
. . . E 571
. . . D 431
. . . C 207
. . . C 377
. . . C 204
. . . C 377
. . . F 303
. . . C 193
. . . F 301
. . . A 267
. . . F 473
. . . C 410
. . . F 260
. . . D 432
. . . E 607
. . . B 185
. . . C 536
. . . .B 31
strona Nazwa firmy
44
44
44
44
44
44
45
45
45
45
45
46
46
46
47
47
47
47
47
47
47
48
48
48
48
48
48
49
49
49
49
49
49
49
49
50
50
50
51
51
51
51
51
52
52
52
52
52
52
53
53
53
53
53
54
FIRMA ROZALCZYK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . .
FIRMA USŁUGOWO-HANDLOWA DARIUSZ WICHTOWSKI . . . . . . .
FIRMA WW WIESŁAW WŁAZAŁEK . . . . . . . . . . . . . . . . . . . .
FLIEGL AGRARTECHNIK GmbH . . . . . . . . . . . . . . . . . . . . .
FLORA Sp. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
FLORIAN CENTRUM S.A. . . . . . . . . . . . . . . . . . . . . . . . . .
FOG AGROTECHNIK POLAND Sp. z o.o. . . . . . . . . . . . . . . . . .
FOKUS P.P.H.U. RADOSŁAW FIBNER WALDEMAR STASZAK . . . . . .
FORTIS TECHNOLOGY SP. Z O.O. SP.K. . . . . . . . . . . . . . . . . .
FORTPOL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . .
FOSFAN S.A.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
FOSFORY Gdańskie Zakłady Nawozów Fosforowych Sp. z o.o. . . . . .
FRACOP Sp. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . . .
FRISOMAT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . .
FUCHS OIL CORPORATION (PL) Sp. z o.o. . . . . . . . . . . . . . . .
GALERIA KSEN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . .
GAMA P.H.U. SZEPIETOWSCY SP.J. . . . . . . . . . . . . . . . . . . .
GASPOL S.A.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
GEM-EKO Rafał Rogowski . . . . . . . . . . . . . . . . . . . . . . . . .
GENEU Beata Jerczyńska . . . . . . . . . . . . . . . . . . . . . . . . .
GEO Di BOERI GIOVANNA . . . . . . . . . . . . . . . . . . . . . . . .
GERPOL SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . .
GEYER&HOSAJA Sp. z o.o. Zakłady Gumowe w Partyni . . . . . . . . .
GIEŁDAROLNA.PL . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
GIZEX PHPU Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . .
GŁÓWNY INSPEKTORAT PRACY W WARSZAWIE . . . . . . . . . . . .
GOSPODARZ.PL - TWÓJ PORTAL ROLNICZY . . . . . . . . . . . . . .
GÓRNICZE ZAKŁADY DOLOMITOWE SPÓŁKA AKCYJNA . . . . . . . .
GRANIT Parts Części Zamienne Sp. z o.o. Sp.k. . . . . . . . . . . . . .
GRANO-SYSTEM ILONA KULETA . . . . . . . . . . . . . . . . . . . . .
GRANUM FIRMA NASIENNA J. Manias, S. Menc, J. Szymański Sp.j. . .
GRASDORF KOŁA POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . .
GRASO Zenon Sobiecki . . . . . . . . . . . . . . . . . . . . . . . . . .
GREENLAND TECHNOLOGIA EM Sp. z o.o. . . . . . . . . . . . . . . .
GREENOK.PL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
GREGOIRE-BESSON POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . .
GRIMME LANDMASCHINENFABRIK GmbH & Co.KG . . . . . . . . . .
GRUPA AZOTY S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . .
GRUPA AZOTY ZAKŁADY AZOTOWE KĘDZIERZYN S.A. . . . . . . . .
GRUPA AZOTY ZAKŁADY AZOTOWE PUŁAWY S.A. . . . . . . . . . . .
GRUPA AZOTY ZAKŁADY CHEMICZNE POLICE S.A . . . . . . . . . . .
GRUPA CB PREFABRYKACJA Sp. z o.o. . . . . . . . . . . . . . . . . .
GRUPA INCO S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
GRUPA TOPEX Sp. z o.o. Sp.k. . . . . . . . . . . . . . . . . . . . . . .
GUMSTAL Stanisława Lubiszewska . . . . . . . . . . . . . . . . . . . .
GXL POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . .
HAGE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . .
HANDEL ARTYKUŁAMI KONSUMPCYJNYMI WIESŁAW NOWAKOWSKI
HANDLOPEX S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
HARDI GMBH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
HEDAN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
HEIN Sp. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
HENRYK Firma Henryk Batyra. . . . . . . . . . . . . . . . . . . . . . .
HERBERT DAMMANN GMBH . . . . . . . . . . . . . . . . . . . . . . .
HERMON CZECH & MUZIA SP.J. . . . . . . . . . . . . . . . . . . . . .
HEWEA CENTRUM TECHNIKI CARGO Sp. z o.o. . . . . . . . . . . . .
HF INVERTER POLSKA S.C.. . . . . . . . . . . . . . . . . . . . . . . .
HIFI FILTER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . .
HODOWCA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . .
sektor, nr stoiska/hala
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
. . . . B 345
. . . . F 462
. . . . F 460
. . . . D 220
. . . . A 330
. . . . D 540
. . . . F 463
. . . . D 570
. . . . D 90
. . . . D 413
. . . . A 316
. . . . A 315
. . . . E 298
. . . . C 533
. . . . C 41
. . . . D 556
. . . . F 483
. . . . D 415
. . . . F 458
. . . . F 491
. . . . . A2
. . . . F 142
. . . . F 476
. . . . C 377
. . . . E 590
. . . . C 397
. . . . C 76
. . C hala 12
. . . . C 43
. . . . .B 21
. . C hala 10
. . . . E 124
. . . . D 562
. . . . A 329
. . . . A 322
. . . . E 295
. . . . C 279
. . . . A 315
. A315,A327
. . . . A 315
A A315,E603
. . . . F 467
. . . . B 338
. . C hala 19
. . . . C 515
. . . . D 85
. . . . E 300
. . . . D 554
. . . . E 125
. . . . E 300
. . C hala 39
. . . . .B 24
. . . . F 259
. . . . C 280
. . . . .B 36
. . C hala 16
. . . . E 589
. . C hala 33
. . . . F 487
Alfabetyczny spis wystawców
Alphabetical list of exhibitors
strona Nazwa firmy
54
54
54
54
54
55
55
55
55
55
55
56
56
56
56
56
56
56
56
57
57
57
57
57
57
57
57
58
58
58
58
58
58
59
59
59
59
59
59
59
60
60
60
60
60
61
61
61
61
61
61
62
62
62
sektor, nr stoiska/hala
HODOWLA ROŚLIN SMOLICE Sp. z o.o. Grupa IHAR . . . . . . . . . . . . . . . . . . . . . . . .
HODOWLA ROŚLIN STRZELCE Sp. z o.o. Grupa IHAR . . . . . . . . . . . . . . . . . . . . . . .
HOG SLAT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
HOHBURG MINERALFUTTER GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
HOMBURG MACHINEHANDEL B.V. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
HORSCH MASCHINEN GMBH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
HORTMASZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
HUPRO, spol. S.r.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
HURTOWNIA OGRODNICZA BOGDAN KRÓLIK . . . . . . . . . . . . . . . . . . . . . . . . . . .
HUSQVARNA POLAND SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
HYDRAMET PPHU Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
HYDROKIT . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
HYDRO-MASZ SĘCERSKI SPÓŁKA JAWNA PRZEDSIĘBIORSTWO PRODUKCYJNO-HANDLOWE
HYDROMETAL TOMASZ KOWALEWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
HYDROPRESS HYDRAULIKA SIŁOWA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
HYDROTOR Przedsiębiorstwo Hydrauliki Siłowej S.A. . . . . . . . . . . . . . . . . . . . . . . . .
HZPC POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
IGAMET Mechanika Maszyn i Urządzeń Rolniczych Janusz Komorowski . . . . . . . . . . . . . .
IMPULS-LEASING POLSKA Sp. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
INDUSTRA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
INDUSTRIEHOF SCHERENBOSTEL HEINRICH RODENBOSTEL GmbH . . . . . . . . . . . . . .
INDUSTRY DIESEL & OIL Sp. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
INFOMAX Działowski, Lewicki, Szczepanik Z.P.Ch. Spółka Jawna . . . . . . . . . . . . . . . . . .
ING USŁUGI FINANSOWE S.A . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
INOFAMA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
INSEFARM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
INSTYTUT ZOOTECHNIKI PAŃSTWOWY INSTYTUT BADAWCZY . . . . . . . . . . . . . . . . . .
INTER CARS S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
INTER IMPORT-EXPORT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
INTERHANDLER Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
INTER-LERS Sp. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
INTER-TECH P.P.H.U. Piotr Jankowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
INVENTOR JOŃSKI JAN . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
INWEST-AGRO TECHNICZNA OBSŁUGA ROLNICTWA WOJCIECH SIEŃKO . . . . . . . . . . . .
IOW SERVICE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
IOW TRADE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ITALCOM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
IZOLACJE PLUIMERS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
J.A. GĄSKA Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
JANSSEN POLAND Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
JAR-MET Spółka Jawna Dariusz Sińczuk, Tomasz Sternicki . . . . . . . . . . . . . . . . . . . . .
JFC POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
JMK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
JOHN DEERE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
JOSERA POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
JOSKIN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
JUNKKARI POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
K i J S.C. Przedsiębiorstwo Wielobranżowe. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
K+S POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KABAT Spółka Jawna . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KABER GRZEGORZ SCHEINKE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KAGRO Krzysztof Pankowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KARCHEX MACIEJ JEŻ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KAROL Sp. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KASA ROLNICZEGO UBEZPIECZENIA SPOŁECZNEGO Oddział Regionalny w Poznaniu . . . . .
KAZGOD Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KELLFRI SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KESSENS TECHNIK MIT SYSTEM GmbH & Co.KG . . . . . . . . . . . . . . . . . . . . . . . . .
KIELECKIE KOPALNIE SUROWCÓW MINERALNYCH S.A. . . . . . . . . . . . . . . . . . . . . .
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
. . . B 358
. . . B 359
. . . E 439
. . . B 345
. . . D 79
. . . F 307
. . . E 231
. . . D 549
. . . B 369
. . . F 242
. . . A 169
. . . E 298
. . . C 205
. . . F 243
. . . F 161
. . . F 160
. . . B 371
. . . F 256
. . . D 83
. . . F 148
. . . C 46
. . . D 82
. .C hala 1
. . . C 529
. . . E 438
. . . F 473
. C hala 22
. . . C 54
. . . .B 23
. . . C 277
. . . D 420
. . . D 599
. . . .A 16
. . . F 470
. . . E 123
. . . E 123
. . . F 167
. . . E 574
. . . F 132
. . . E 229
. . . F 301
. . . F 477
. . . E 127
. . . B 273
. . . B 350
. . . D 289
. . . D 294
. . . D 95
. . . A 312
. . . E 129
. . . F 149
. . . B 188
. . . E 585
. . . D 427
. . . C 396
. . . A 333
. . . E 235
. . . C 85
. C hala 41
strona Nazwa firmy
62
62
62
63
63
63
63
63
63
64
64
64
64
64
64
64
65
65
65
65
65
66
66
66
66
66
67
67
67
67
67
67
67
68
68
68
68
68
68
68
69
69
69
69
69
69
69
70
70
70
70
70
70
71
71
sektor, nr stoiska/hala
KING TONY POLSKA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KINGSPAN ENVIRONMENTAL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KINGSPAN INSULATION Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KLAUS-PETER ZANDER Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KLIMTOP CONTROLS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KMK AGRO D. Kaźmierczak, C.Mądry, M. Kaźmierczak Sp.j.. . . . . . . . . . . . . . . . . . .
KNOTT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KOBEX HALE I WIATY STALOWE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KOBZARENKO Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KÖCKERLING GmbH & Co. KG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KOMATSU POLAND Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KOMFORT Zakład Produkcyjno-Usługowo-handlowy . . . . . . . . . . . . . . . . . . . . . .
KONAR P.H.U. S.C.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KONGSKILDE-POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KONRAD P.H. Krzysztof Przeździecki . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KONSIL PRZEDSIĘBIORSTWO OBSŁUGI ROLNICTWA . . . . . . . . . . . . . . . . . . . . .
KOPALNIA SOLI KŁODAWA SPÓŁKA AKCYJNA . . . . . . . . . . . . . . . . . . . . . . . . .
KORBANEK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KOWALSCY PRODUKCJA MASZYN ROLNICZYCH I CZĘŚCI ZAMIENNYCH SPÓŁKA JAWNA .
KRAJOWA RADA IZB ROLNICZYCH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KRAMER-WERKE GmbH. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KRAMP SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KREBECK STALLEINRICHTUNGEN UND APPARATEBAU GmbH . . . . . . . . . . . . . . . .
KRUSZEC ZAKŁAD USŁUGOWO-PRODUKCYJNY . . . . . . . . . . . . . . . . . . . . . . . .
KSM TRADING Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KST KONSULTING Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KUBOTA (DEUTSCHLAND) GmbH Sp. z o.o. Oddział w Polsce . . . . . . . . . . . . . . . . .
KUHN-Maszyny Rolnicze Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KUJAWSKA FABRYKA MASZYN ROLNICZYCH Sp. z o.o. . . . . . . . . . . . . . . . . . . . .
KVERNELAND GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KWAZAR CORPORATION Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KWS LOCHOW POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KWS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
LANTMÄNNEN SW SEED Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
LECHLER GmbH. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
LE-GUM P.P. HANDEL I SERWIS URZĄDZEŃ WULKANIZACYJNYCH . . . . . . . . . . . . . .
LELY EAST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
LEMKEN POLSKA Sp. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
LIBERO SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
LIRA Wytwórnia Pasz Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
LOGIS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
LP. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
LSN LUBLIN . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
LUCAS.G . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
LUDWIG BERGMANN GmbH Maschinenfabrik . . . . . . . . . . . . . . . . . . . . . . . . . .
LUPUS FIRMA HANDLOWA SYLWESTER WILK . . . . . . . . . . . . . . . . . . . . . . . . .
LUVENA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ŁUCZAK MASZYNY ROLNICZE Stanisław Łuczak . . . . . . . . . . . . . . . . . . . . . . . .
ŁUKOMET KRZYSZTOF ŁUSZCZYK. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MADAR RENATA SCHMIDT . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MADEJSKI Spółka Jawna . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MADOKS Dariusz Przegaliński. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MAGROTEX Przedsiębiorstwo Produkcyjno Usługowe Sp. z o.o. . . . . . . . . . . . . . . . .
MAKITA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MALINMAR JANINA MALINOWSKA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MAŁOPOLSKA HODOWLA ROŚLIN HBP Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . .
MANDAM SP. Z O.O. PRZEDSIĘBIORSTWO PRODUKCYJNO HANDLOWE . . . . . . . . . .
MANITOU POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MARAX R.RAJ Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
. . . F 157
. . . D 87
. . . E 447
. . . E 602
. . . C 503
. . . F 301
. . . C 73
. . . D 538
. . . F 250
. . . B 189
. . . D 218
. . . D 94
. . . D 566
. . . E 300
. . . E 575
. . . C 395
. . . B 339
. . . B 269
. . . . A1
. C hala 24
. . . D 214
. . . C 42
. . . C 404
. . . C 519
. . . C 525
. . . C 496
. . . A 268
. . . B 272
. . . C 203
. . . B 271
. . . C 66
. . . B 354
. . . B 355
. . . B 364
. . . C 281
. . . E 126
. . . E 296
. . . F 308
. . . F 489
. . . E 583
. . . C 517
. . . E 227
. C hala 34
. . . .B 27
. . . F 258
. . . A 265
. . . A 325
. . . F 240
. . . C 202
. . . F 152
. C hala 18
. . . C 529
. . . C 388
. . . F 241
. C hala 17
. . . B 360
. . . D 224
. . . E 295
. . . E 444
Alfabetyczny spis wystawców
Alphabetical list of exhibitors
strona Nazwa firmy
71
71
71
71
72
72
72
72
72
72
73
73
73
73
74
74
74
74
75
75
75
75
75
75
76
76
76
76
76
76
76
77
77
77
77
77
78
78
78
78
78
79
79
79
79
79
79
80
73
80
80
80
80
80
sektor, nr stoiska/hala
MARKET ROLNICZY MINGE SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MARMA POLSKIE FOLIE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MAROLEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MASCAR SPA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MASCHIO-GASPARDO POLAND Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MAXYGEN P.P.H.U. EXPORT-IMPORT SYLWIA DUDEK . . . . . . . . . . . . . . . . . . . . . . . . .
MAZOWECKIE CENTRUM HODOWLI I ROZRODU ZWIERZĄT Sp. z o.o. . . . . . . . . . . . . . . .
MCHALE ENGINEERING LIMITED . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MECHANIK S.C. ZAKŁAD USŁUGOWO-HANDLOWY STANISŁAW ZARZECKI, JAN TOMASZEWSKI
MECHANIKA MASZYN I URZĄDZEŃ ROLNICZYCH TOMASZ PINKOWSKI . . . . . . . . . . . . . .
MEC-POL SUSZARNIE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MEPROZET KOŚCIAN S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MEPU OY. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MERITUM BANK ICB S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MERLO POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MESCOMP-OPRYSKIWACZE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
METALERG Sp. z o.o. S.K.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
METAL-FACH SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
METALINVEST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
METALTECH ZAKŁAD MECHANICZNY Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . .
METAL-TECHNIK S.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MIARY I WAGI Tomasz Kogut Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MICHALAK PRZEDSIĘBIORSTWO PRODUKCYJNO-HANDLOWO-USŁUGOWE . . . . . . . . . . .
MICHAŁ ZPUH Krzysztof Targoński . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MIĘDZYNARODOWE TARGI POZNAŃSKIE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . .
MILTOM-EKO SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MINISTERSTWO ROLNICTWA I ROZWOJU WSI . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MIROL Zakład Handlowo-Usługowy Mieczysław Michalski . . . . . . . . . . . . . . . . . . . . . . .
MMAT MARIAN MIKOŁAJCZAK AGRO TECHNOLOGY . . . . . . . . . . . . . . . . . . . . . . . . .
MOSKIT PRZEDSIĘBIORSTWO PRODUKCYJNO USŁUGOWO HANDLOWE . . . . . . . . . . . . .
MOTO-BUS WĄTROBA, ANDREARCZYK SP.J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
M-ROL SPÓŁKA Z OGRANICZONĄ ODPOWIEDZIALNOŚCIĄ SP.K. . . . . . . . . . . . . . . . . . .
MS AGROTECH Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MUELLER ELEKTRONIK GMBH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MURATOR S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
NAJBAR F. H.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
NDS-GRZEGORZ MICHAŁEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
NEOROL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
NEUERO FARM FORDERTECHNIK GMBH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
NEW HOLLAND . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
NEXT SPÓŁKA JAWNA DOROTA I PIOTR LIPSCY . . . . . . . . . . . . . . . . . . . . . . . . . . .
NIJHUIS WATER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
NOWA WIEŚ EUROPEJSKA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
NT INDUSTRY SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
OIL CENTER Sp. z o.o. Sp.k. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
OKNA AMATI ANETA LUDWICZAK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
OMARV SRL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
OMNIVENT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
OPALL-AGRI s.r.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ORLEN GAZ Sp. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
OSI POLAND FOODWORKS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
OTOMOTO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
OTTO TH. MENKE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
P.H.U. TRANS STACHOWIAK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
P.P.U.H. AGOS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PARTNER SYSTEMS SPÓŁKA Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PAT Chomutow SP.J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PEDROTTI POLSKA Sp. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PELLON SP. Z O.O.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
. . . A 317
. . . C 511
. . . C 64
. . . B 179
. . . A 262
. . . F 472
. . . E 610
. . . D 291
. . . F 145
. . . E 116
. . . D 416
. . . D 293
. . . D 294
. . . E 582
. . . F 311
. . . C 194
. . . D 564
. . . D 292
. . . C 206
. . . C 276
. . . D 287
. . . E 443
. . . .A 10
. . . D 423
. . . D 91
. . . C 202
. . . C 396
. . . A 263
. . . C 62
. . . C 193
. . . F 139
. . . C 390
. . . C 389
. . . C 281
. . . C 381
. . . F 252
. . . B 177
. . . B 346
. C hala 28
. . . C 282
. . . D 539
. . . E 584
. . . C 612
. . . F 257
. . . D 107
. . . D 544
. . . E 446
. . . C 524
. . . .B 25
. . . C 385
. . . F 478
. . . B 186
. . . C 45
. . . E 587
. . . C 409
. . . D 86
. . . D 425
. . . D 417
. . . F 484
strona Nazwa firmy
80
81
81
81
81
81
81
81
82
82
82
82
82
83
83
83
83
83
84
84
84
84
1
84
85
85
85
85
85
85
86
86
86
86
86
86
86
87
87
87
87
87
88
88
88
88
88
88
89
89
89
89
sektor, nr stoiska/hala
PERKOZ PRZEDSIĘBIORSTWO HANDLOWO-USŁUGOWE Sp. z o.o.. . . . . . . . . . . . . . . . . .
PESSL INSTRUMENTS GMBH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PETER KRÖGER GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PETROCONSULTING Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PEWAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PHU UNI-TRADE SP.J. B. DOMAŃSKA, J. DOMAŃSKI EXPORT-IMPORT . . . . . . . . . . . . . . . .
PIAST PASZE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PICHON S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PIG-SIN IMPORT-EXPORT . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PISEK-VITLI KRPAN d.o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PITERN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PLANDEKI-RASZYN MARCIN KOWALSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PLANTA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PLANTICO - HODOWLA I NASIENNICTWO OGRODNICZE ZIELONKI Sp. z o.o. . . . . . . . . . . . .
PLANTPRESS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PLATINUM OIL WIELKOPOLSKIE CENTRUM DYSTRYBUCJI SP. Z O.O.. . . . . . . . . . . . . . . . .
PLOTTNIK AGROCONSULTING . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PNEUMAPOL JANKOWSCY SP.J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PNEUSEJ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
POLBOTO-AGRI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
POLCALC Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
POL-CAR Przedsiębiorstwo Motoryzacyjne Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . .
POLNET Sp. z o.o. I WSPÓLNICY SPÓŁKA KOMANDYTOWA . . . . . . . . . . . . . . . . . . . . . .
POLSIL BIOPREPARATY SPÓŁKA JAWNA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Polska Izba Gospodarcza Maszyn i Urządzeń Rolniczych . . . . . . . . . . . . . . . . . . . . . . . .
POLSKIE WYDAWNICTWO ROLNICZE Sp. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . . .
POLSKIE ZRZESZENIE PRODUCENTÓW BYDŁA MIĘSNEGO . . . . . . . . . . . . . . . . . . . . . .
POL-STRAUTMANN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
POM KALISZ PPHiU Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
POM Ltd Spółka z ograniczoną odpowiedzialnością . . . . . . . . . . . . . . . . . . . . . . . . . . .
POM-AGRO Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
POMAROL S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
POMORSKO MAZURSKA HODOWLA ZIEMNIAKA Sp. z o.o. w STRZEKĘCINIE . . . . . . . . . . . .
POMOT PUP SP. Z O.O. (Chojna) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PORSCHE INTER AUTO POLSKA Sp. z o.o.- SALON VOLKSWAGEN SAMOCHODY UŻYTKOWE . . .
Poznańska Hodowla Roślin Sp. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PRACOWNICZY OŚRODEK MASZYNOWY W AUGUSTOWIE Sp. z o.o.. . . . . . . . . . . . . . . . .
PRECON POLSKA S. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PRECYZYJNEROLNICTWO.COM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PREMIUM TRADE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PRIVE. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PRO AGRICOLA SZP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PROGRASS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PROKMAR S.C. MARZENA WASZKOWIAK, KRZYSZTOF WASZKOWIAK . . . . . . . . . . . . . . . .
PRO-LAB PPHU Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PROMAR - Zakład Produkcji Maszyn Rolniczych Dariusz Nowak . . . . . . . . . . . . . . . . . . . .
PRONAR PHU DARIUSZ KAWKA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PROTECHNIKA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PRO-VEGA Sp.j. M. WRÓBLEWSKI, M. ŁUKASIEWICZ . . . . . . . . . . . . . . . . . . . . . . . . . .
PROVSOLAR . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PRZEDSIĘBIORSTWO ROMANOWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PRZEDSIĘBIORSTWO WIELOBRANŻOWE BORYS S.C. WALDEMAR KACZMAREK, PATRYK LATOS .
PRZEMYSŁOWY INSTYTUT MOTORYZACJI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PTM TRADE-CENTRUM RUCHOMYCH PODŁÓG . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PUCCIONI S.p.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PZU S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
R.B. USŁUGI I HANDEL RENATA NIESOBSKA-LAURSEN . . . . . . . . . . . . . . . . . . . . . . . .
R.J.-ROLIMPEX Przedsiębiorstwo Produkcyjno-Handlowe . . . . . . . . . . . . . . . . . . . . . . . .
RABAUD . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
. . . B 184
. . . C 281
. . . E 238
. . . E 114
. . . E 113
. C hala 35
. . . B 340
. . . B 183
. . . E 452
. . . C 595
. . . F 459
. . . D 541
. . . C 512
. . . B 370
. A8,C380
. . . C 52
. . . C 404
. . . F 158
. . . .B 26
. . . D 79
. . . A 331
. . . C 522
. . . E 441
. . . B 341
. . . . . C
. . . C 40
. . . E 122
. . . A 175
. . . C 409
. . . C 191
. .C hala 8
. . . .B 38
. .C hala 5
. . . C 276
. . . C 523
. . . B 361
. . . C 276
. . . E 449
. . . D 109
. . . .B 38
. . . E 298
. . . C 498
. . . . A3
. . . .B 34
. . . A 324
. . . C 196
. . . D 104
. . . D 89
. . . C 527
. . . F 457
. . . D 286
. . . D 421
. . . .A 11
. . . E 233
. C hala 11
. . . E 232
. . . . A7
. . . F 486
. . . E 298
Alfabetyczny spis wystawców
Alphabetical list of exhibitors
strona Nazwa firmy
89
89
90
90
90
90
90
90
91
91
91
91
91
91
92
92
92
92
92
92
93
93
93
93
93
93
93
94
94
94
94
94
94
95
95
95
95
96
96
96
96
96
96
97
97
97
97
97
97
98
98
98
98
98
99
sektor, nr stoiska/hala
RAIFFEISEN AGRO-TECHNIKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . .
RAIFFEISEN-LEASING POLSKA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
RAPOOL POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
REMPRODEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
REMSZ KLIMCZAK Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
RESTAL ZAKŁAD WYROBÓW METALOWYCH ELŻBIETA REMBIASZ . . . . . . . . . . . . . .
RICHEL SERRES DE FRANCE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
RICHIGER (LANDTECHNIK GUT RENZOW GMBH) . . . . . . . . . . . . . . . . . . . . . . .
RIELA POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
RO.SA-HALE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ROBELIT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ROLAND FIRMA PRODUKCJA HANDEL USŁUGI Ryszard Drąg . . . . . . . . . . . . . . . . .
ROLKAP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ROLMAKO P.H.U.T.P. HENRYK KOWALSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ROLMASZ-POL PRZEDSIĘBIORSTWO HANDLOWO-USŁUGOWE . . . . . . . . . . . . . . .
ROLMET Zakład Wytwórczo-Usługowy s.c. . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ROLMETAL Przedsiębiorstwo Produkcyjno Handlowe Teresa Kubańska, Jacek Kubański Sp.j.
ROLMUS P.P.H.U.T. EXPORT-IMPORT MIECZYSŁAW SZYMKOWIAK. . . . . . . . . . . . . . .
ROLNICTWO PRECYZYJNE ANDRZEJ PRZEPERSKI . . . . . . . . . . . . . . . . . . . . . .
ROLNICTWO.COM.PL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ROLSTAL Pawłowski Pawłowski Janusz. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ROLTECH-CONOW Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ROLTOP SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ROLTRANS PHUP WALDEMAR KOBYLIŃSKI . . . . . . . . . . . . . . . . . . . . . . . . . . .
ROLUB TRADING Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
RYU ARM POLSKA JADWIGA SZCZUREK . . . . . . . . . . . . . . . . . . . . . . . . . . . .
S.C. TOMIT AGRI MACCHINE SRL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
S’A’D’ POLAND Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
SALES PRODUCTION CONSULTING Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . .
SALIDA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
SAMASZ Sp. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
SAME DEUTZ - FAHR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
SANDHILLS EAST LTD-MARKETBOOK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
SANO - NOWOCZESNE ŻYWIENIE ZWIERZĄT Sp. z o.o. . . . . . . . . . . . . . . . . . . . .
SAUTER GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
SCHAEFFLER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
SCHARMUELLER GESELLSCHAFT m.b.H & CoKG . . . . . . . . . . . . . . . . . . . . . . .
SCHAUMANN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
SCHUITEMAKER MACHINES B.V.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
SEKO KOTŁY CENTRALNEGO OGRZEWANIA . . . . . . . . . . . . . . . . . . . . . . . . . .
SERAFIN P.U.H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
SERWIS-CENTRUM Sp. z o.o. PRZEDSIĘBIORSTWO WIELOBRANŻOWE . . . . . . . . . . .
SERWIS-SKLEP ALTERNATORÓW I ROZRUSZNIKÓW Stanisław Osiński . . . . . . . . . . . .
SF-FILTER Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
SG EQUIPMENT LEASING POLSKA SP. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . .
SIAL W. KIMBER, B. KIMBER, H. KIMBER Spółka Jawna. . . . . . . . . . . . . . . . . . . . .
SIEMENS FINANCE Sp. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
SILOTECH KOMOROWSKI SPÓŁKA JAWNA . . . . . . . . . . . . . . . . . . . . . . . . . . .
SIMENA SPÓŁDZIELNIA Z.P.CH. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
SIPMA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
SITAMET WYTWÓRNIA SIT - NAPRAWA MASZYN CZYSZCZĄCYCH . . . . . . . . . . . . . .
SITONO WYTWÓRNIA SIT KRZYSZTOF NOWAKOWSKI . . . . . . . . . . . . . . . . . . . . .
SKOTAREK Produkcja Maszyn Rolniczych i Części Jerzy Skotarek . . . . . . . . . . . . . . .
SKRAW-MET HYDRAULIKA SIŁOWA Sp. z o.o. S.K. . . . . . . . . . . . . . . . . . . . . . . .
SOCIETE PROMODIS (SPÓŁKA AKCYJNA SPÓŁDZIELNIA) ODDZIAŁ W POLSCE . . . . . . .
SOLAN T.CZECH, Ł.CZECH Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
SOLIDEAL POLSKA S.A.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
SPAREX POLSKA SP. Z O.O.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
SPAWEX Sławomir Próżanin. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
. . . C 280
. . . C 384
. . . B 367
. . . F 253
. . . C 68
. . . D 413
. . . D 551
. . . .B 32
. . . D 290
. C hala 15
. . . D 539
. . . F 488
. . . E 576
. . . A 176
. . . F 136
. . . C 392
. . . A 172
. . . F 165
. . . D 96
. C hala 26
. . . F 456
. . . F 248
. . . C 274
. . . F 251
. . . . A7
. . . E 451
. . . E 605
. . . D 428
. . . F 246
. . . C 402
. . . D 292
. . . C 275
. C hala 21
. . . B 352
. . . F 150
. . . E 604
. . . C 205
. . . B 349
. . . E 131
. . . D 568
. . . D 294
. . . F 475
. . . F 144
. . . D 108
. . . E 454
. . . E 594
. . . B 178
. . . D 426
. . . F 135
. . . C 212
. . . D 430
. . . C 386
. . . C 198
. . . D 78
. . . B 180
. . . C 521
. . . E 128
. . . E 115
. . . . A6
strona Nazwa firmy
99
99
99
100
100
100
100
100
100
101
101
101
101
101
102
102
102
102
102
103
103
103
103
103
103
103
103
103
104
104
104
104
104
105
105
105
105
105
105
106
106
106
106
107
107
107
107
107
107
107
108
108
sektor, nr stoiska/hala
SPÓJNIA HODOWLA I NASIENNICTWO OGRODNICZE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . B 363
SPÓŁDZIELNIA INWESTYCJI I BUDOWNICTWA W ŁOWICZU . . . . . . . . . . . . . . . . . . . . . . . . . . . F 465
STACJA HODOWLI I UNASIENIENIA ZWIERZĄT Sp. z o.o. w Bydgoszczy . . . . . . . . . . . . . . . . . . . . D 557
STAL IMPEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . D 542
STALMACH MACHOWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . D 545
STALMECH Bogumił Księżakowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F 245
STALTECH Grzegorz Dobrzański . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . B 181
STANIMPEX MACIEJ PACKIEWICZ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C 57
STEELPRESS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 121
STEYR . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . D 284
STILL POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C 534
STOMIL SANOK - DYSTRYBUCJA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . D 102
STORTI SpA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F 304
STOWARZYSZENIE POLSKI ZIEMNIAK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .C hala 9
SUMERA MOTOR SPÓŁKA JAWNA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C 596
Sunds Alfa - Member of IBF Group . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F 464
SWIMER OTREMBA ŁUKASZ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E120, C209, E445
SW-STAHL & WERKZEUGVERTRIEBS GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C 45
SZARAFIN PRZEDSIĘBIORSTWO PRODUKCYJNO-HANDLOWO-USŁUGOWE TOMASZ SZARAFIN . . . . . . F 146
SZNAJDER F.H.U. ELŻBIETA SZNAJDER . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . D 81
TAD-LEN PPHU Światła Tadeusz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C 195
TALEX L. JAWORSKI I WSPÓLNICY SPÓŁKA JAWNA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . B 185
TAMA POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C 502
TARGI KIELCE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C hala 30
TARGOWA OFICYNA WYDAWNICZA Magdalena Kunikowska . . . . . . . . . . . . . . . . . . . . . . . . . .C hala 4
TASOMIX WYTWÓRNIA PASZ I KONCENTRATÓW . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . B 342
TEAM OF AGRA Sp. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . D 222
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F 305
TECHMET A.M.M.Z. JUZWA SPÓŁKA JAWNA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C 530
TECHMOT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . D 105
TECHMOT Sp. z o.o. (Opole) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . A 320
TEHNOS d.o.o. Zalec . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C 595
TERPLAST Sp. z o.o. Zakłady Przetwórstwa Tworzyw Sztucznych . . . . . . . . . . . . . . . . . . . . . . . . C 520
TERRAEXIM-AGROIMPEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 436
TEXA POLAND Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C 53
THYE LOKENBERG-POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 433
TOKO AGRI a.s. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 592
TOLMET ZAKŁAD PRODUKCYJNO-USŁUGOWO-HANDLOWY PIOTR WAWRZYNIAK . . . . . . . . . . . . . . C 59
TOMASZ OLSZAK P.P.H.U. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .A 18
TOOLMEX TRUCK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C 375
TORAL Techniczno - Handlowa Obsługa Rolnictwa Elżbieta Krupa . . . . . . . . . . . . . . . . . . . . . . . . C 211
TORNUM POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C 407
TOTAL POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 111
TOUT POUR LE GRAIN (TPLG) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 298
TRAILER-TECH SPÓŁKA Z O.O . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 238
TRAMP J.J. Mikusz Sp. J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 591
TRINKER . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 227
TROUW NUTRITION POLSKA AP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . B 344
TRUCK&VAN . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C 493
TUBES INTERNATIONAL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C 51
TVR Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . A 266
TYWENT Sp. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 586
UAB JUBANA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C hala 36
UAB WESTERN FABRICATIONS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . F 249
UBI FRANCE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 298
UNIA Sp. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C 278
UNIMETAL SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . D 419
UNIROL PARTS SP. Z O.O. SP.K. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C 48
UNIWERSYTET PRZYRODNICZY W POZNANIU . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . B 365
Alfabetyczny spis wystawców
Alphabetical list of exhibitors
strona Nazwa firmy
108
108
108
108
109
109
109
109
110
110
110
110
110
110
110
110
111
111
111
111
111
112
112
112
112
112
112
113
113
113
113
113
113
113
114
114
114
114
114
114
115
115
115
115
115
115
115
116
116
116
116
116
116
sektor, nr stoiska/hala
USŁUGI OGÓLNOBUDOWLANE ROBERT CIESIELSKI . . . . . . . . . . . . . . . . . . . . .
UTECH Maszyny i Urządzenia Techniczne Norbert Koenig . . . . . . . . . . . . . . . . . . . .
V. ORLANDI POLAND Sp. z o.o. Sp.k.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
V.V.M TECHTRADE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
VÄDERSTAD Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
VB LEASING POLSKA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
VILOFOSS POLSKA Sp. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
VIRAGO PRODUKT S.C. J.ŁUCZAK, A.ŁUCZAK . . . . . . . . . . . . . . . . . . . . . . . . .
VOGEL&NOOT Polska Sławomir Langner . . . . . . . . . . . . . . . . . . . . . . . . . . . .
VOGELSANG Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
VOLANT Przedsiębiorstwo Produkcyjno Handlowo Usługowe D.Grabowski U. Grabowska S.c.
VRETEN AB . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
WALD-GOLD Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
WALTER WATSON LTD . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
WEIDEMANN POLSKA. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
WEREMCZUK FMR Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
WESEM D.M.T. HAJDUK SPÓŁKA JAWNA . . . . . . . . . . . . . . . . . . . . . . . . . . . .
WESSTRON - PRODUKT S.C. M.ROGOZIEWICZ-LEWANDOWSKA, JANUSZ LEWANDOWSKI
WIADOMOŚCI ROLNICZE POLSKA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
WIELKOPOLSKI OŚRODEK DORADZTWA ROLNICZEGO . . . . . . . . . . . . . . . . . . . .
WIELKOPOLSKIE CENTRUM HODOWLI I ROZRODU ZWIERZĄT W Poznaniu Sp. z o.o. . . . .
WIELKOPOLSKIE STOWARZYSZENIE SOŁTYSÓW - GAZETA SOŁECKA . . . . . . . . . . . .
WIELKOPOLSKIE WYDAWNICTWO ROLNICZE Sp. z o.o. . . . . . . . . . . . . . . . . . . . .
WIELTON S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
WIEŚCI ROLNICZE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
WILHELM STOLL MASCHINENFABRIK GmbH . . . . . . . . . . . . . . . . . . . . . . . . . .
WIMAR Mariusz Wiśniewski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
WOLF SYSTEM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
WOL-MET ROMAN WOLNY . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
WOPROL PRZEDSIĘBIORSTWO PRODUKCYJNO-USŁUGOWO-HANDLOWE Jerzy Worek . .
WYDAWNICTWO TRUCK AUTO KOMIS / CZASOPISMO MOTOFARMER.PL . . . . . . . . . .
WYRÓB GALANTERII Z METALU WALTERSCHEID-SERVICE . . . . . . . . . . . . . . . . . .
WYTWÓRNIA FILTRÓW „PZL-SĘDZISZÓW” S.A. . . . . . . . . . . . . . . . . . . . . . . . . .
WYTWÓRNIA USZCZELEK MORPAK Paweł Jaworski . . . . . . . . . . . . . . . . . . . . . .
YARA POLAND Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Z.B.P.S. KEMPF Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Z.H.U. ARGO PAWEŁ KALIŃSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ZAKŁAD DOŚWIADCZALNY OCENY ODMIAN ŚREM-WÓJTOSTWO . . . . . . . . . . . . . .
ZAKŁAD MECHANICZNY PROGRESS Leszek Sawicki . . . . . . . . . . . . . . . . . . . . . .
ZAKŁAD MECHANIKI MASZYN I URZĄDZEŃ ROLNICZYCH SŁAWOMIR BIARDZKI . . . . . .
ZAKŁAD MECHANIZMÓW NAPĘDOWYCH S.C. Gabryjela Szydłowska Roman Tański . . . . .
ZAKŁAD METALOWY AGROMASZ GRUSZCZEWSKI JANUSZ. . . . . . . . . . . . . . . . . .
ZAKŁAD NAPRAWCZY MECHANIZACJI ROLNICTWA JAN KUCHARSKI . . . . . . . . . . . .
ZAKŁAD PRODUKCYJNO HANDLOWY STANISŁAW KRZACZEK . . . . . . . . . . . . . . . .
ZAKŁAD ŚLUSARSKI GREŃ S.J. Bolesław i Grażyna Greń . . . . . . . . . . . . . . . . . . . .
ZAKŁADY CHEMICZNE SIARKOPOL TARNOBRZEG Sp. z o.o. . . . . . . . . . . . . . . . . .
ZAKŁADY GÓRNICZO-METALOWE „ZĘBIEC” W ZĘBCU SPÓŁKA AKCYJNA . . . . . . . . . .
ZAKŁADY METALOWE W PRZYSIEKACH SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . .
ZAKŁADY SPRZĘTU MECHANICZNEGO URSUS Sp. z o.o. . . . . . . . . . . . . . . . . . . .
ZAMARTE HODOWLA ZIEMNIAKA Sp. z o.o. Grupa IHAR . . . . . . . . . . . . . . . . . . . .
ZAMET ZAKŁAD PRODUKCYJNO-USŁUGOWY Ryszard I Marcin Zabielscy Sp.j. . . . . . . . .
ZASŁAW TSS Sp. z o.o. Sp.k. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ZETOR POLSKA Sp. z o.o.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ZIELONY SZTANDAR . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ZŁOTECKI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ZOCON. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ZUIDBERG FRONTLINE SYSTEMS BV . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ZUMEC Zakład Urządzeń Mechanicznych Eugeniusz Cieśla. . . . . . . . . . . . . . . . . . .
ZUPTOR SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
.
. . . D 546
. . . .A 17
. . . D 80
. . . E 436
. . . F 309
. . . D 225
. . . E 300
. . . F 156
. . . D 223
. . . C 200
. . . .B 30
. . . C 504
. . . D 553
. . . C 398
. . . D 288
. . . C 526
. . . F 155
. . . E 437
. . . C 376
. . . C 400
. C hala 14
. . . C 379
. . . C 497
. . . B 190
. . . C 528
. . . B 187
. . . C 505
. . . D 537
. . . .B 22
. . . C 208
. . . C 499
. . . A 263
. . . D 548
. . . D 99
. . . A 313
. . . F 247
. . . C 67
. . . B 366
. . . D 550
. . . C 59
. . . F 140
. . . F 261
. . . D 103
. . . D 569
. . . E 453
. . . A 314
. . . F 147
. . . F 466
. . . D 106
. .C hala 6
. . . .B 33
. . . C 283
. . . E 297
. .C hala 3
. . . F 153
. . . D 559
. . . D 79
. . . C 393
. . . D 412
Spis YystaYcÎY
List of exhibitors
Polska Izba Gospodarcza Maszyn i Urządzeń Rolniczych
ul. Poznańska 118
87–100 Toruń
tel.: +48 56 651 47 40
fax: +48 56 651 47 44
e-mail: [email protected]
www.agroshow.pl
Polska Izba Gospodarcza Maszyn i Urządzeń Rolniczych istnieje od 1999 roku. Jest organizacją o zasięgu ogólnokrajowym. Zrzesza podmioty gospodarcze oferujące najnowocześniejsze maszyny i urządzenia dla rolnictwa. Zapraszamy już
teraz na organizowaną przez nas Międzynarodową Wystawę
Rolniczą ZIELONE AGRO SHOW – POLSKIE ZBOŻA, 7-8
czerwca 2014, Sielinko, gmina Opalenica. XVI Międzynarodową Wystawę Rolniczą AGRO SHOW 2014, 19-22 września
2014, Bednary. Więcej informacji na stronie www.pigmiur.pl
Spis wystawców
List of exhibitors
44 TUNING - PRZEDSIĘBIORSTWO 44 Joanna Halicka
ul. Opolska 30
46-022 Kępa k. Opola
tel.: +48 77 423 12 45
kom.: +48 604 532 800
e-mail: [email protected]
www.44tuning.pl
Bezpieczne optymalizacje i zwiększanie mocy, zmniejszanie
zużycia paliwa nawet o 26%, pomiary mocy (hamownie obciążeniowe), diagnostyka w maszynach rolniczych, samochodach ciężarowych, dostawczych i osobowych. Dojeżdżamy
do klientów na terenie całej Polski.
Safe optimization and increasing power, reducing fuel consumption even by to 26%, power measurements (dynamometer), diagnostics in tractors, trucks, vans and cars. We arrive
to the customers in all area of Poland.
Stoisko: C 494
ABZ Adam Zacharow
ul. Szkolna 96B
62-002 Suchy Las
tel.: +48 61 649 10 72
fax: +48 61 855 29 09
e-mail: [email protected]
www.geodrill.pl
Stoisko: D 555
ACO Funki AS
Kirkevaenget 5
DK-7400 Herning, Dania
tel.: +48 606 23 95 23
fax: +48 25 681 22 83
e-mail: [email protected]
www.acofunki.com
ADNAR – Kołodziejczyk Daniel producent wysokiej jakości
silosów lejowych i płaskodennych wykonanych z blachy
falistej, suszarń stacjonarnych pracujących na podciśnieniu,
podnośników kubełkowych, przenośników taśmowych oraz
przenośników łańcuchowych (redlerów). Oferujemy również
czyszczalnie zbożowe, wialnie, konstrukcje wsporcze, rury, kolana, rozdzielacze, sterowanie obiektów. Firma nasza zapewnia
serwis na terenie całego kraju oraz doradztwo techniczne przy
projektowaniu obiektów magazynowo-suszarniczych.
ADNAR – Kołodziejczyk Daniel, a producer of high-quality
funnel flow and flat bottom silos of corrugated steel, stationary
vacuum dryers, bucket, belt and chain (redler) conveyors. We
also offer grain cleaners, winnowers, supporting structures, pipes, elbows, separators, and control of facilities. Our company
offers maintenance servicing throughout Poland and technical
counselling for designing storage and drying facilities.
Stoisko: C 405
Stoisko: E 450
Przedsiębiorstwo Wielobranżowe AGAT
Piotr Jasiński
Kopana, ul. Słoneczna 33
05-555 Tarczyn
tel.: +48 691 512 867, +48 22 7278294
P.W. AGAT zajmuje się dystrybucją systemów opielaczy
niemieckiej firmy KULT KRESS stosowanych w szkółkach
owocowych, ozdobnych, leśnych i uprawach warzywniczych.
Jesteśmy także przedstawicielem słoweńskiej firmy CERJAK
produkującej wałki napędowo-przegubowe.
ADEL Zakład Elektroniczny
ul. Gitarowa 1/2
51-531 Wrocław
tel./fax: +48 71 302 75 48
e-mail: [email protected]
www.adel.pl
Firma ADEL istnieje od 1997 roku. Specjalizuje się w
produkcji urządzeń elektronicznych do maszyn rolniczych.
Produkujemy całą gamę produktów; od prostych liczników
hektarów, poprzez sterowniki układów hydraulicznych, a
kończąc na rozbudowanych urządzeniach sterujących dawką
oprysku lub rozsiewu.
ADEL Company is active since 1997, and it is a specialist in
production of electronic equipment for agricultural machines.
We produce a wide range of products, from simple counter of
hectares, through hydraulic system controllers to sophisticated controllers of spraying or sowing dose.
Stoisko: hala 31
2
ADNAR
Kołodziejczyk Daniel
Biuro konstrukcyjne
ul. Ożynowa 51 a
53-009 Wrocław
Zakład produkcyjny
ul. Inżynierska 3
55-220 Jelcz Laskowice
tel.: +48 71 723 46 38
fax: +48 71 723 49 38
kom.: +48 601 050 838, 785 199 171
e-mail: [email protected]
www.adnar.pl
The P.W.AGAT company distribute systems of Fingerweeder
of German company KULT KRESS used in fruit nursery, forest
nursery and vegetable cultivations. We are also dealer of
Slovenian company CERJAK who produce P.T.O. drive shafts.
Stoisko: C 506
AGCO Sp. z o.o.
ul. Poznańska 5
62-021 Paczkowo
tel.: +48 61 662 90 50, 61 662 90 54,
A
+48 61 662 90 53 (serwis),
fax: +48 61 662 90 58,
e-mail: [email protected]
www.valtra.pl
Firma AGCO Sp. z o.o. oferuje ciągniki kołowe Valtra o mocy
od 74 do 370 KM oraz ciągniki gąsiennicowe o mocy od
335 do 609 KM i opryskiwacze samobieżne marki Chllenger.
Koncern AGCO oferuje także maszyny do zbioru zielonek –
FELLA.
The company AGCO Sp. z o.o. offers Valtra wheel tractors
of 74 to 370 HP, tracked tractors of 335 to 609 HP and self-propelled sprayers of Challenger. The AGCO company also
offers hay tools – FELLA.
Stoisko: D 285
Agencja Nasienna Sp. z o.o.
ul. Jana Dekana 6E
64-100 Leszno
tel.: +48 65 529 31 61-62
fax: +48 65 520 30 62
kom.: +48 697 010 968
e-mail: zarzą[email protected]
www.agencjanasienna.pl
Agencja Nasienna Sp. z o.o. jest obecnie organizacją 19
hodowców roślin rolniczych, za pomocą której, mogą oni
kolektywnie egzekwować wyłączne prawo do odmian roślin
poprzez: kontrolę przedsiębiorców realizujących umowy
licencyjne z hodowcami na produkcję i obrót kwalifikowanym
materiałem siewnym; przeciwdziałanie naruszeniom wyłącznego prawa, a zwłaszcza nielegalnemu obrotowi materiałem
siewnym; zbieranie i kontrolę informacji o korzystaniu z
odstępstwa rolnego; zbieranie opłat przysługujących za
korzystanie z odstępstwa rolnego.
Agencja Nasienna Sp. z o.o. performs a function of a breeders
organisation representing 19 breeders. We support legal use
of plant varieties protected by exclusive rights and our tasks
are following: to control entrepreneurs who realise licence
agreements with breeders to produce and sell certified
seed; to counteract exclusive rights infringement, especially
seed illegal trading; to collect and control information about
enjoying FSS privilege; to realise collective system of FSS
charges gathering.
Stoisko: B 356
Agencja Nieruchomości Rolnych
ul. Dolańskiego 2
00-215 Warszawa
tel.: +48 22 452 54 00
fax: +48 22 452 55 91
e-mail: [email protected]
www.anr.gov.pl
Stoisko: C 396
Agencja Promocji Rolnictwa i Agrobiznesu
APRA Sp. z o.o.
ul. Bażancia 1
Myślęcinek
86-031 Osielsko
tel.: +48 52 584 17 40
e-mail: [email protected]
www.apra.pl
APRA – wydawca polskiej ogólnopolskiej prasy rolniczej,
czasopism: „Nowoczesna Uprawa”, „Rolniczy Przegląd
Techniczny”, „Rolnik Dzierżawca”, „Hoduj z głową bydło”,
„Hoduj z głową świnie”, „Agroenergetyka”, „Poradnik Plantatora Buraka Cukrowego” oraz miesięcznika „Ciężarówki”. Ma
nowoczesne studio graficzne i drukarnię – jej innowacyjne
rozwiązania technologiczne były współfinansowane przez
Unię Europejską. Wydawnictwo drukuje swoje czasopisma
i realizuje zlecenia zewnętrzne na druk czasopism, książek
folderów, ulotek.
Nowoczesna Uprawa – ogólnopolski miesięcznik, który
ma profil nieporównywalny z żadnym innym czasopismem
na polskim rynku wydawniczym. Jego tematyka obejmuje
fachowe doradztwo technologiczne z uwzględnieniem bieżącej
sytuacji, sezonowości i nowoczesnych rozwiązań. „Nowoczesną Uprawę” czytają rolnicy otwarci na wiedzę i stosowanie
innowacyjnych rozwiązań. Inwestują oni w swój warsztat
pracy i skutecznie wykorzystują dostępne fundusze. e-mail:
[email protected], www.nowoczesnauprawa.pl
Rolniczy Przegląd Techniczny – ogólnopolski miesięcznik, od
12 lat jest dla swoich Czytelników głównym źródłem wiedzy i
pierwszym doradcą w zakresie doboru technologii oraz sprzętu dla ich gospodarstw. W RPT znajdziesz: testy, parametry
techniczne, dane użytkowe maszyn, ceny ciągników nowych
i używanych, nowości rynkowe, słownik techniki rolniczej,
bezpłatne ogłoszenia drobne. e-mail: [email protected], www.rpt.pl
APRA - is the publishing company of Polish agriculture magazines such as: „Nowoczesna Uprawa”, „Rolniczy Przegląd
Techniczny”, „Rolnik Dzierżawca”, Hoduj z głową bydło”, „Hoduj z głową świnie”, „Agroenergetyka”, „Poradnik Plantatora
Buraka Cukrowego”. APRA owns a modern graphic studio
and a printing house – its innovative technological solutions
were co-financed by European Union. Apart from editing its
own magazines APRA fulfills various printing orders (leaflets,
books, folders, posters, etc.) from different clients.
Nowoczesna Uprawa – an eminent Polish monthly magazine
concentrated on subjects connected with technical expert counseling, considering the present market situation, seasonality
and modern solutions. „Nowoczesna Uprawa” is subscribed
by open-minded farmers, who want to get more practical
knowledge about innovative imrovements. They invest in their
farms and effectively use available funds.
Rolniczy Przegląd Techniczny – Polish monthly magazine
3
Spis wystawców
List of exhibitors
which for the last 12 years has been the main source of
knowledge for its readers, and the first technological adviser
as well. In the magazine one can find information about:
tests, technical parameters, machine data, prices of new and
thirdhand tractors, market novelties, dictionary of agriculture
engeneering, free classified adds.
Rolnik Dzierżawca – Polish monthly magazine for readers
involved with modern agriculture business – owners of
agricultural enterprises and tenants with large area. In the
magazine one can find inforamtion connected with running the
large agriculture buiness, landholding, law, present market,
present agro-markings and agro- and zootechnical novelties.
Stoisko: A9, B39, F239, A332, C382, E442
Agencja Restrukturyzacji i Modernizacji Rolnictwa
Al. Jana Pawła II 70
00-175 Warszawa
bezpłatna infolinia: 800 38 00 84
e-mail: [email protected]
www.arimr.gov.pl
Powstała w 1994 r. Agencja Restrukturyzacji i Modernizacji
Rolnictwa, jest agencją płatniczą, która realizuje cele Wspólnej
Polityki Rolnej UE. Wypłaca m.in. dopłaty bezpośrednie - w
Polsce co roku otrzymuje je około 1,4 mln rolników, wspiera
rozwój obszarów wiejskich (PROW 2007 - 2013) oraz modernizację sektora rybackiego (PO RYBY 2007 - 2013), a także
pomaga w spłacie preferencyjnych kredytów.
mes and the schemes financed from the state budget, i.a.:
carries out intervention buy-in and sale of agricultural
commodities and processed products, manages production
quota systems, foreign trade and Promotion Funds, supports
promotion and consumption of food products.
Stoisko: C 396
AGE-POWER Sp.J.
ul. Grudowska 65
05-822 Milanówek
tel.: +48 22 724 55 07
e-mail: [email protected]
[email protected]
[email protected]
www.age-power.pl
NIEZALEŻNY IMPORTER SILNIKÓW ORAZ ORYGINALNYCH
CZĘŚCI ZAMIENNYCH DEUTZ, Serwis pogwarancyjny wszystkich silników DEUTZ, Dojazd do maszyn na terenie całego
kraju, Remonty główne silników - gwarancja 1 rok bez limitów
rbh, Oryginalne części zamienne. Age-Power - wyłączny
importer agregatów prądotwórczych oraz maszyn BENZA. W
naszej ofercie znajdą Państwo: agregaty prądotwórcze, agregaty spawalnicze, motopompy, motospawarki, piły do asfaltu
i betonu. Oferujemy również pełną paletę części zamiennych,
nowe silniki, silniki używane oraz silniki po remoncie niemieckiej marki DEUTZ. Zapewniamy również wyspecjalizowany
serwis silników DEUTZ
Stoisko: E 117
Established in 1994, the Agency for Restructuring and
Modernisation of Agriculture is a paying agency which deals
with the Common Agricultural Policy of the European Union. It
provides aid from national funds to almost 1.400.000 farmers,
it supports the development of rural areas, it modernises
fisheries sector and helps to repay preferential loans.
Stoisko: C 396
Agencja Rynku Rolnego
Oddział Terenowy w Poznaniu
ul. Marcelińska 90
60-324 Poznań
tel.: +48 61 852 14 33
fax: +48 61 853 67 95
www.arr.gov.pl
4
Firma Handlowo-Usługowa "AGMA" Maciej Kaźmierczak
ul. Folwarczna 26A/5
61-064 Poznań
tel.: +48 506 034 485
fax: +48 61 871 32 35
Firma zajmuje się sprzedażą hurtową elektronarzędzi Makita,
Einhell, Bosch, Dewalt, Milwaukee, Hitachi, Celma oraz
sprzętu budowlanego zagęszczarek, betoniarek, agregatów
prądotwórczych, sprężarek, kosiarek, odśnieżarek, pomp
spalinowych, traktorków rolniczych firmy Pezal.
Stoisko: F 134
Agencja Rynku Rolnego administruje wybranymi mechanizmami wspólnej polityki rolnej i finansowanymi z budżetu
krajowego, m.in.: prowadzi interwencyjny zakup i sprzedaż
produktów rolnych i ich przetworów, administruje systemami
kwotowania produkcji, obrotem towarowym z zagranicą i
funduszami promocji, wspiera promocję produktów żywnościowych oraz ich konsumpcję.
AgrAlex
78-325 Redło 57
tel.: +48 94 36 50 010-11
fax: +48 94 36 45 439
e-mail: [email protected]
www.agralex.pl
The Agricultural Market Agency (Agencja Rynku Rolnego,
ARR) implements selected Common Agricultural Policy sche-
AgrAlex jest firmą Polską istniejącą od 1991 roku. AgrAlex jest
kompleksowym dostawcą profesjonalnej technologii w zakresie urządzeń transportujących, maszyn czyszczących, inno-
A
wacyjnych suszarni zbożowych. Dostarczamy i produkujemy
rozwiązania do magazynów zbożowych, obiektów nasiennych,
terminali portowych. Największy producent zaprawiarek na
świecie. Jesteśmy również generalnym wykonawcą obiektów.
AgrAlex is a Polish company existnig since 1991. AgrAlex is
a comprehensive provider of professional technologies for
transporting equipment, cleaning machines, innovative cereal
dryer. We supply and manufacture solutions for magazines,
producing objects, the port terminals. The largest manufacturer of treaters in the world. We are also the general contractor.
Stoisko: C 408
AGRARIUS Sp. z o. o.
ul. Klimeckiego 14
30-705 Kraków
tel./fax: +48 12 652 76 97
e-mail: [email protected]
www.agrarius.eu
Agratechniek b.v.
Kruiswijk 4
1761 AR Anna Paulowna
The Netherlands
tel.: +31.(0)223 - 52.2824
fax: +31.(0)223 - 52.1949
e-mail: [email protected]
Agratechniek b.v.- Czołowy producent wyposażenia
przechowalni płodów rolnych. W ofercie systemy zarządzające przechowalniami ziemniaków cebuli, warzyw, cebulek
kwiatowych. Wyposażenie przechowalni do przechowywania
w pryzmie lub w skrzyniach. Przedstawiciel na Polskę:
Polboto-Agri Sp. z o.o.
Stoisko: D 79
AGRARIUS Sp. z o. o. – wyłączny dystrybutor NANO-GRO®
organicznego stymulatora wzrostu i plonowania, preparatów
humusowych LIGNOhumat oraz specjalistycznych preparatów
bakteryjnych.
AGRARIUS Ltd. - an exclusive distributor of NANO-GRO®
organic plant growth and yield stimulator, products based
on humic substances LIGNOhumat and specialized bacterial
products.
Stoisko: B 336
AGRAR
SAM
AGRARSAM Sp. z o.o.
ul. Rycerska 11
64-920 Piła
tel./fax: +48 67 283 88 93
e-mail: [email protected]
www.hawe-wester.de
www.krampe.de
AGREMO Sp. z o.o.
ul. Parkowa 7
49-318 Skarbimierz Osiedle
tel.: +48 77 402 94 60
fax: +48 77 402 94 80
e-mail: [email protected]
www.agremo.pl
Głównym kierunkiem działalności firmy jest produkcja
urządzeń magazynów zbożowych. W oparciu o własne produkty AGREMO projektuje i kompletuje magazyny zbożowe,
realizując „pod klucz” zarówno małe obiekty farmerskie dla
rolników indywidualnych i firm, jak i duże bazy magazynowe.
W ofercie AGREMO SP Z O.O. znajdują się: silosy z lejem
zsypowym V=30 - 800m3; silosy płaskodenne V=60 6000m3, suszarne zbożowe o wydajnościach od 3t/h do
30t/h; podnośniki kubełkowe, przenośniki łańcuchowe,
ślimakowe i taśmowe; mieszalnie pasz o wydajnościach: 1
t/h – 20t/h.
Stoisko: C 391
Firma AGRARSAM zajmuje się sprzedażą przyczep i pojazdów
transportowych następujących firm: HAWE: przyczepy przeładowcze do zboża i buraków, obornika i wapna, objętościowe,
przesuwające, wywrotki. KRAMPE: przyczepy wywrotki –
wannowe Big Body, przesuwające Pandit.
The company AGRARSAM sells trailers and transport vehicles
from the following companies: HAWE: trailers for grain and
beetroot, manure and lime spreaders, tank trailers, conveyor
belt and tipper trailers. KRAMPE: tipper-halfpipe trailers, Big
Body, conveyor belt and tipper trailers
Stoisko: E 234
Agri Con Sp. z o.o.
Precision Farming Company
ul. Struga 78
70-784 Szczecin
tel./fax: +48 91 465 56 61
www.agriconpolska.pl
[email protected]
Agri Con Precision Farming Company proponuje rozwiązania
rolnictwa precyzyjnego: systemy nawożenia Yara N-Sensor®
i N-Tester®, systemy automatycznego prowadzenia maszyn
firmy Trimble, systemy zmiennego wysiewu nawozów na
podstawie map aplikacyjnych, mapy zasobności i skanowanie
elektromagnetyczne.
Agri Con Precision Farmin Company offers precision farming
solutions: nitrogen applications with Yara N-Sensor® and
5
Spis wystawców
List of exhibitors
N-Tester®, Trimble GPS autoguide systems, variable fertilizer
spreading based on application maps. We offer services of
soil testing and scanning with EM-38 electromagnetic scanner
Stoisko: D 100
Agriaffaires.pl
98, Allée des Champs Elysées
91080 Courcouronnes
Francja
tel.: +33 1 60 87 92 40
fax: +33 1 60 87 17 61
e-mail: [email protected]
www.agriaffaires.pl
In 1973, a group of potato growers joined forces to create
one, new cooperative. This signaled the birth of Agrico. Now,
years later, this cooperation has evolved into an organization
that markets potatoes all over the globe, breeds new varieties
and invents innovative solutions. This demands a lot of effort,
but we know what motivates us: providing the best potato for
millions of consumers all over the world. Agrico Poland is the
exclusive representative of Agrico in Poland. We import from
Holland high grade seed potatoes and make reproduction in
the North of Poland, the healthiest area of potato production in
Poland, near the Baltic Sea.
Stoisko: hala 7
Agriaffaires (www.agriaffaires.pl ) z ponad 6 milionami odwiedzinami na miesiąc* i 16 wersjami językowymi, Agriaffaires
jest pierwszym w Europie branżowym portalem Kupna i
Sprzedaży Nowych i Używanych Maszyn Rolniczych. Agriaffaires, to również profesjonalne internetowe miejsce wymiany
i spotkań rolników, dealerów, producentów oferujące ponad
250 000 ogłoszeń kupna i sprzedaży maszyn rolniczych z
Polski, Niemczech, Francji i całego świata. * Dane za okres od
01/01 do 31/01 2013, źródło Xiti.
Agriaffaires (www.agriaffaires.pl), with more than 6 million
visits per month* is the leading European website for buying
and selling new and used farm equipment. Available in 16
languages, this marketplace is for all farming professionals
(farmers, dealers and manufacturers), and offers more than
250,000 ads from Poland, Germany, France and all around the
world. *Xiti Source, January 2013.
Stoisko: B 334
Agrifac Machinery B.V.
Eesveenseweg 15
8332 JA Steenwijk
Holandia
Jarosław Kowalewski
tel.: +48 695 746 901
e-mail: [email protected]
www.agrifac.pl
Agrifac produkuje opryskiwacze polowe, kombajny do
buraków cukrowych oraz maszyny do czyszczenia drenów.
Szeroki wybór maszyn używanych, np.: Riecam, Amac,
WKM i Armar Salmon. Wszystkie maszyny projektowane są
zgodnie z zasadą „4E’s for growers”: Efektywność, Ekonomia,
Ergonomia i Ekologia.
Agrifac manufactures trailed and selfpropelled sprayers,
sugar beet harvesters and draincleaners. Wide range of used
equipment and parts for Amac, Riecam, Sieger and WKM.
Machines are developed according to the “4 Es for growers”
concept: Efficiency, Economy, Ergonomy and Ecology.
Stoisko: E 299
Agrico Polska Sp. z o.o.
ul. Staromiejska 7 A
84-300 Lębork
tel.: +48 59 862 45 14
fax: +48 59 862 79 55
e-mail: [email protected]
www.agricopolska.pl
Agrico Polska jest jedynym przedstawicielem Agrico Holland
w Polsce. Importujemy z Holandii zdrowe sadzeniaki
ziemniaka w stopniu kwalifikacji BI oraz BII, które następnie
rozmnażamy w rejonie północnej Polski do stopni kwalifikacji
CA oraz CB. Nasze plantacje zlokalizowane są w pierwszej
strefie zdrowotności ziemniaka, w pasie Morza Bałtyckiego
co umożliwia prowadzenie nasiennictwa ziemniaka w sposób
efektywny. Eksportujemy sadzeniaki ziemniaka do hodowców
na całym świecie. Mogą oni wybierać z ponad 80 różnych
odmian, które są uprawiane przez ponad 60 wyspecjalizowanych hodowców Agrico. Jakikolwiek rodzaj ziemniaka
potrzebuje klient, mamy odpowiednią odmianę. Oferujemy naszym odbiorcom stałą jakość, szeroki wybór odmian bardzo
wczesnych lub średnio-wczesnych z oferty Agrico Polska lub
import każdej odmiany prosto z Holandii.
6
agriKomp Polska Sp. z o.o.
Ostrzeszów 63-500
tel.: +48 601 568 582
agriKomp Polska Sp. z o.o. jest częścią niemieckiej grupy agriKomp GmbH zajmującej się projektowaniem, budową w systemie gospodarczym i „pod klucz” oraz serwisem biogazowni
rolniczych. Zrealizowaliśmy ponad 1200 projektów w całej
Europie. Nasza pierwsza instalacja w Polsce o mocy 660kW
osiągnęła sprawność 97%. W tym roku nasza firma uruchomi
dwie kolejne instalacje w Polsce o mocy 800 i 999 kW.
agriKomp Poland Sp. z o.o. [Ltd.] is part of the German agriKomp GmbH group involved in the design, construction in the
economy system, "turn-key" and servicing of biogas plants.
We have completed over 1,200 projects across Europe. Our
first installation in Poland with a power of 660kW reached an
efficiency 97%. This year our company will launch two new
biogas plants in Poland, with a power of 800 and 999 kW.
Stoisko: E 452
A
AGRIMPEX Sp. z o.o.
37-500 Jarosław
ul. Zwierzyniecka 2
tel.: +48 16 621 34 08
fax: +48 16 623 61 51
e-mail: [email protected]
www.agrimpex.pl
Agrimpex Spółka z o.o. to prężnie działająca firma w
branży rolniczo-ogrodniczej, której głównymi markami są
agrowłókniny Pegas Agro oraz Agrimpex. Ofertę kierujemy do
profesjonalnych rolników i hobbystów - miłośników ogrodu,
którym zależy na jakości i profesjonalnej obsłudze. Oprócz
Agrowłóknin znajdą Państwo w naszej ofercie znakomitej
jakości Węgierskie Folie Tunelowe.
Agrimpex Spółka z o.o. is a company active in agricultural and
gardening sectors, with crop cover and mulch fabric brands
such as Pegas Agro and Agrimpex. Our main goal is regular
product development, product portfolio enlargement as well
as meeting the needs of professional farmers and hobby
garden lovers. Our offer is directed to all those who care for
quality and professional service. We have also in our offer
Hungarian green house films of excellent quality.
Stoisko: C 513
AGRIO MODERNI ZEMEDELSKE SLUZBY s.r.o.
Kremze 74
382-03 Kremze
e-mail: [email protected]
www.agrio.cz
Przedstawiciele
Polska połnocna-zachodnia, centralna
oraz północno-wschodnia
„GABO”Spółka Cywilna
Sarzyn 15
09-440 Staroźreby
tel./fax: +48 24 261 25 24
e-mail: [email protected]
www.gabosc.pl
Polska południowa:
Jan Hajka
Jamnice 14
746 01 Opava
tel./fax: +420 553 661 125
kom.: +420 777 910 947
e-mail: [email protected]
Firma AGRIO założona w 1993 roku oferuje szeroką gamę
produktów do ochrony roślin. Poprzez rozwinięty system
dystrybucji jesteśmy obecni w 5 krajach Europy. AGRIO
specjalizuje się w produkcji profesjonalnych opryskiwaczy
do ochrony roślin. Nasze opryskiwacze należą do czołówki
światowej. Często byliśmy pierwszym przedsiębiorstwem,
które stosowało najnowocześniejsze technologie aplikacji
pestycydów w Europie Środkowej. Oferta produkcyjna
zawiera opryskiwacze ciągane i samojezdne o zasięgu
ramion do 36 m. i pojemności zbiornika od 2000 do 8000
litrów.
Agrinavia Polska Sp. z o.o.
ul. Dr A.Schmidta 1, Żołędowo
86-031 Osielsko
tel.: +48 52 381 36 01
kom.: +48 515 230 958
e-mail: [email protected]
www.agrinavia.pl
Stoisko: F 303
Oferujemy profesjonalne oprogramowanie do zarządzania
gospodarstwem z produkcją roślinną. Program posiada:
Ewidencję pól, zabiegów, działek ewidencyjnych, asystenta
nawożenia mineralnego i organicznego, magazyny, raporty
ekonomiczne, sprawozdawcze, unijne, mapy, wersję na
smartfony, bazę nawozów i ŚOR z producentem, składem,
poziomem toksyczności, datą zezwolenia, etykietą. Agrinavia
jest przystosowywana do IP oraz Integrowanej Ochrony
Roślin. Cena zawiera wdrożenie, pełen serwis i wsparcie
podczas użytkowania.
We offer professional software for farm management of
crop production. The program features: Records of fields,
operations, cadastral parcels, assistant fertilization, organic
fertilization module, storage,economic reports, reporting,
EU, maps, version for smartphones, base of plant protection
products: manufacturer, composition, degree of toxicity, the
date of authorization, label. Agrinavia is adapted for IP and
Integrated Pest Management. Price includes implementation,
full service and support during use.
Agripak Sp. z o.o. Sp. k.
Stary Drzewicz 3
96-315 Wiskitki
tel./fax: +48 46 856 73 82
e-mail: [email protected]
www.agripak.pl
Firma Agripak Sp. z o.o. Sp. k. istnieje od 2007 roku i
zajmuje się nowoczesnymi technologiami dla rolnictwa. W
naszej ofercie znajduje się sprzedaż i wynajem nowoczesnych maszyn rolniczych takich jak: suszarnie przewoźne
(Agrimec, Esma); gniotowniki (Renn Mill); śrutowniki (Geringhoff); prasy silosujące (Kelly Ryan); pakowaczki (Agripak).
Przy pomocy maszyn, świadczymy usługi dla rolnictwa na
terenie całego kraju. Oferujemy także się rękawy foliowe,
służące do magazynowania płodów rolnych, belgijskiej firmy
HYPLAST N.V.
Stoisko: C 406
Stoisko: E 300
7
Spis wystawców
List of exhibitors
Agrisem International
439 rue de l etang-Beauce
44-850 Ligne, Francja
tel.: +33 2 40 77 40 48
fax: +33 2 40 77 45 45
e-mail: [email protected]
www.agrisem.com
Stoisko: F 306
The Company activities include wholesale and retail of: spare
parts produced by the companies such as: Accord, Amazone,
Claas, John Deere, Farmet (GX i K-600), Fortschritt, G.Besson, Kuhn, Kverneland, Lemken, Maschio, MF, Niemeyer,
Overum, Rabewerk, Ross(PHX, PB), Unia, Vogel&Noot, knives
for fodder cars: Alfa Laval, Marmix, Sano, Sgariboldi, Seko,
filters produced by Fleetguard.
Stoisko: D 101
Agro Serwis
ul. Świętokrzyska 20
00-002 Warszawa
tel./fax: +48 22 827 24 01
e-mail: [email protected]
agroserwis.pol.pl
Stoisko: C 378
AGRO ZAOPATRZENIE Sp. z o.o.
ul. Grunwaldzka 497
80-309 Gdańsk
e-mail: [email protected]
www.agro.gda.pl
AGRO ZAOPATRZENIE jest wyłącznych przedstawicielem handlowym producenta "FREGATA" S.A. która od
wielu lat jest znana jako renomowany i jeden z najbardziej
rozpoznawalnych producentów preparatów biobójczych
( gryzoniobójczych i owadobójczych), środków ochrony
roślin, maści ogrodniczych oraz pasty BLACK-OUT. Oferujemy preparaty wysokiej jakości, atrakcyjną cenę i pełną
satysfakcję Klientów.
AGRO ZAOPATRZENIE is an sole sales representative of
"FREGATA" S.A. which is for many years known as reputable
and one of the most recognizable manufacturers of biocidal
products in Poland (rodenticides and insecticides), plant
protection products, horticultural ointments and BLACK-OUT
paste. We offer high quality products, keen prices and full
satisfaction of Customers.
Stoisko: D 560
AGROBERG Renata i Stanisław Berg s. c.
ul. Saperów 222
85-542 Bydgoszcz
tel.: +48 52 320 95 26, 322 07 68
fax: +48 52 320 95 25
e-mail: [email protected]
Firma Agro-Bis
ul. Przemysłowa 21
84-214 Bożepole Wielkie
tel./fax: +48 58 678 97 97
e-mail: [email protected]
www.agrobis.eu
Nasza firma od lat zajmuje się sprzedażą części i akcesorii
do zachodnich maszyn rolniczych takich firm jak Claas,
Welger, John Deere oraz innych producentów maszyn
wykorzystywanych w gospodarstwach rolnych. W naszej
ofercie znajdą Państwo szeroką gamę produktów dla
swoich maszyn, które dzięki nim będą pracować jak nowe
przez długie lata. Jesteśmy również w szerokim zakresie
producentami części zamiennych do zachodnich maszyn
rolniczych po bardzo konkurencyjnych cenach. Nasze
punkty sprzedaży mieszczą się w: SKR Szytniki koło
Kalisza woj. Wielkoloplskie, Wielbrandowo Zabudowanie
koło Skórcza woj. Pomorskie, Agro-Bis Bożepole Male koło
Wejherowa woj. Pomorskie. Prowadzimy również sprzedaż
wysyłkową. Zapraszamy do naszych sklepów firmowych
lub kontaktu w celu sprzedaży wysyłkowej. http://www.
agrobis.eu/sklep/.
Our company has been involved in the sale of parts and
accessories for Europeen agricultural machinery such as
Claas, Welger, John Deere and other manufacturers of
machines used on farms. We offer a wide range of products
for their machines, which will run for years like new! We also
the produce wholesale and retail of spare parts in a broad
scale for agricultural machines at very competitive prices.Or
expedience and years of presence on the market guarantee
to satisfy our clients. Our points of sale: SKR Szytniki near
Kalisz, province. Wielkoloplskie, Wielbrandowo Zabudowanie
near Skurcz, province. Pomorskie, Agro-Bis Bozepole Male
near Wejherowo, province, Pomorskie. W also provide a Mail
Order Service. Please check out our company sores or visit
our website for more detalis: http://www.agrobis.eu/sklep/.
Stoisko: E 601
Firma prowadzi sprzedaż hurtową i detaliczną: części
zamiennych takich firm jak: Accord, Amazone, Claas,
John Deere, Farmet (GX i K-600), Fortschritt, G.Besson,
Kuhn,Kverneland, Lemken, Maschio, MF, Niemeyer, Overum,
Rabewerk, Renault, Ross (PHX, PB),Unia, Vogel&Noot, noże
do paszowozów: Alfa Laval, Marmix, Sano, Sgariboldi, Seko,
filtry firmy Fleetguard.
Agro-Biznes Sp. J. Sularz, Rudnicki
66-400 Gorzów Wielkopolski
ul. Myśliborska 56
tel.: +48 95 720 62 75
fax: +48 95 731 42 24
e-mail: [email protected]
www.agro-biznes.pl
Stoisko: A 328
8
A
Agrobud Przedsiębiorstwo Wielobranżowe
ul. Wojnowo 33/10
86-014 Sicienko
tel.: +48 52 381 54 42
fax: +48 52 381 54 42
kom.: +48 512 265 177
Agrocomplex
ul. Szkolna 7
Żółwin
05-807 Podkowa Leśna
+48 22 731 16 60
[email protected]
www.agrocomplex.pl
Firma „AGROBUD” powstała z myślą o nowoczesnym
rolnictwie. Zajmujemy się budową oraz przebudową
budynków inwentarskich, zwracając szczególną uwagę na
wydajność gospodarstwa oraz zadowlonie klienta. Nasze
obiekty realizujemy od projektu poprzez budowę oraz
kompleksowe wyposażenie, a dzięki współpracy z najlepszymi firmami na rynku tworzymy budynki nowoczesne i
funkcjonalne.
Stoisko: D 547
P.P.H.U. AGRO-CZĘŚCI Andrzej Kraus
ul. Nyska 1A
48-320 Skoroszyce
tel.: +48 77 431 80 67
fax: +48 77 431 82 38
e-mail: [email protected]
www.agroczesci.pl
Stoisko: E 438
Stoisko: C 49
AGRO-EKO P.W. Grzegorz Pilch
ul. Raciborska 109
48-130 Kietrz
tel./fax: +48 77 485 50 89
e-mail: [email protected]
Agrochest Sp z o.o.
ul. Cmentarna 13
62-025 Kostrzyn
tel.: +48 61 818 88 88, 61 817 88 21
fax: +48 61 817 88 58
e-mail: [email protected] agrochest.pl
www.agrochest.pl
Oddział Krzemieniewo
ul. Dworcowa 165
64-120 Krzemieniewo
tel.: +48 65 520 22 67
Stoisko: A 263
Firma z wieloletnim doświadczeniem oferuje Państwu: produkty i usługi; nawozy, mikronawozy, środki ochrony roślin,
nasiona kukurydzy, rzepaku i zbóż,własna linia produkcyjna,
skup i kontraktacja płodów rolnych, folie kiszonkarskie i
sznurek rolniczy, pasze i doradztwo rolnicze.
Stoisko: A 318
Agro Chłopecki S.C. R. Chłopecki
D. Chłopecki, M. Chłopecki
87-640 Czernikowo
ul. Toruńska 22
tel.: +48 54 289 42 45
kom.: +48 505 185 399
fax: +48 54 288 92 39
www.agrochlopecki.pl
Agro Chłopecki s.c. importer i dystrybutor wysokiej jakości
Części do zachodnich ciągników i maszyn rolniczych. W
swojej ofercie posiadamy Części silnikowe, tarcze i dociski
sprzęgła, Części do przednich mostów, układów napędowych, hydraulicznych, paliwowych i hamulcowych, pompy
hydrauliczne i filtry do: Massey-Ferguson, Fend, John Deere,
Case IH, Fiat, Ford, New Holland, Landini, Same, Deutz Fahr,
MWM, Perkins. W ofercie posiadam również ciągniki i maszyny rolniczy oraz transport ponadgabarytowy kombajnów i
maszyn rolniczych.
Agencja Akwizycji Commercial Travellers
Przemysław P. Kowalski
Al. Grunwaldzka 487 a
80-309 Gdańsk
tel.: +48 58 552 22 08
fax: +48 58 552 22 10
e-mail: [email protected]
www.agro-expo.pl
Agro-Expo to specjalistyczny magazyn informacyjno
- reklamowy dystrybuowany przez Ośrodki Doradztwa
Rolniczego, Urzędy Gmin i podczas międzynarodowych
imprez rolniczych w kraju i za granicą. Poświęcony jest
tematyce związanej z maszynami rolniczymi i sprzętem
rolniczym. Celem wydawnictwa jest kolportaż informacji
handlowych związanych z obrotem sprzętu rolniczego na
rynku europejskim.
Agro-Expo is a specialist information and advertising magazine distributed through Agricultural Advisory Services and
Community Offices all over Poland and at international trade
fairs home and abroad. It’s devoted to agricultural machinery
and equipment. The purpose of Agro-Expo is to connect
buyers and sellers.
Stoisko: E 602
Agro-Factory
Lubień, 99-100 Łęczyca
tel./fax: +48 24 721 26 95
e-mail: [email protected]
www.agro-factory.pl
Stoisko: B 182
Stoisko: A 19
9
Spis wystawców
List of exhibitors
Agrogrupa Bożena Drabek Spółka-Komandytowo Akcyjna
Os. Kościuszkowców 10/14
62-020 Swarzędz
kom.: +48 519 584 123
Infolinia: +48 61 622 26 31
Adres odbioru części:
ul. Poznańska 99
61-160 Czapury k/Poznania
Agrogrupa to nowoczesna firma w branży rolniczej zajmująca
się kompleksowym zaopatrzeniem, zarówno firm jak i klientów indywidualnych, w części zamienne do ciągników oraz
maszyn rolniczych. Nasz sklep internetowy www.agropomoc.
pl to największa baza części zamiennych w sieci. Naszym
największym atutem są konkurencyjne ceny, wysoka jakość
produktów i szybka dostawa.
Agrogrupa is a modern agricultural company which offers
complex supply of spare parts for tractors and agricultural
machinery.We cooperate with both business and individual
clients. Competitive prices, high quality products and fast
delivery are our biggest advantage.
Stoisko: F 154
Stoisko: C 44
AGROKOMFORT, mgr inż.Marek Malczewski
ul. Zielona 10
89-400 Sępólno Krajeńskie
tel.: +48 603 594 813
fax: +48 52 388 16 77
e-mail: [email protected]
www.agrokomfort.eu
Stoisko: E 578
Internetowy sklep rolniczy? Zakupy z dostawą do domu. Sklep
oferuje: części zamienne do maszyn, ciągników rolniczych
krajowych i zachodnich (np. CLASS, JOHN DEERE, CASE,
FEND, MASSEY FERGUSON, KUHN, UNIA i wiele innych);
filtry, oleje, szyby, przewody hydrauliczne, ogumienie;
oryginalne farby i lakiery do zachodnich ciągników; narzędzia i
artykuły do produkcji rolnej.
ONLINE AGRICULTURAL SHOP. HOME DELIVERY. The shop
offers: spare parts for machines, and for tractors made in
Poland and in the Western Europe (including CLASS, JOHN
DEERE, CASE, FEND, MASSEY FERGUSON, KUHN, UNIA
and other) filters, oils, windscreens, hydraulic lines, tyres;
manufacturer’s paints and coatings for Western tractor; tools
and articles for agricultural production.
Stoisko: F 141
10
We are manufacturer of agricultural machinery parts for combine harvesters and ballers: Claas, Massey Ferguson, John
Deere, New Holland, Deutz Fahr, Rivierre Casalis, Renault,
Welger, parts-belts-chains, import- distribution-production.
We produce all kind of parts, if we don’t have something in us
production we can produce it for You.
Firma Agrokomfort oferuje urządzenia mające ułatwić codzienną obsługę zwierząt oraz polepszyć higienę pomieszczeń
i zdrowotność zwierząt (wykładziny podłogowe na powierzchnie legowiskowe i komunikacyjne w oborach).
Agrohandler Łukasz Woźniak
Czernikówko 59
87-640 Czernikowo
kom.: +48 697 971 745
e-mail.: [email protected]
www.agrohandler.pl
F.H.U.T. Agro-Jan
32-432 Pcim 1147
tel.: +48 12 274 85 76
fax: +48 12 274 80 79
e-mail: [email protected]
www.agrojan.pl
Firma zajmuje się produkcją oraz sprzedażą hurtową i detaliczną części zamiennych do zachodnich maszyn rolniczych:
Claas, Massey Ferguson, John Deere, New Holland, Welger.
Części do: kombajnów, silników, pras kostkujących, pasy:
rolnicze, standardowe, łańcuchy: Galla, Ansi, elewatora
zbożowego, podajnika słomy, Geringhoff, import, dystrybucja,
produkcja. Prowadzimy sprzedaż wysyłkową w 24H.
Agrola Zakład Handlowo-Produkcyjny
Zdzisław Niegowski
Płaktownica 84
07-140 Sadowne
tel.: +48 25 676 0130
fax: +48 25 676 04 98
e-mail: [email protected]
www.agrola.com.pl
Stoisko: C 56
Agroland Sp. z o.o.
04-239 Warszawa
ul. Młodnicka 56
tel.: +48 22 188 50 77
fax: +48 22 205 04 98
kom.: +48 601 299 471, 791 389 389
791 389 388, 607 154 470
e-mail: [email protected]
www.agroland-parts.pl
Doradztwo w doborze, sprzedaż i szkolenia w zakresie części
do maszyn rolniczych I komunalnych, przedstawicielstwo
na Polskę w ramach: wałów przegubowo-teleskopowych i
części firmy Weasler Engineering, noży do maszyn rolniczych,
komunalnych i leśnych firmy MWS Schneidwerkzeuge.
A
Consulting, sales and trainings on spare parts for agricultural
and municipal machines, representation in Poland for: Weasler
PTO shafts and drive line components, MWS blades for
agriculture, forestry and municipal machines.
Stoisko: C 50
AGRO-MASZ Paweł Nowak
Strzelece Małe 78
97-515 Strzelce Małe
tel.: +48 723 998 573
fax: +48 44 787 12 02
e-mail: [email protected]
www.agro-masz.eu
Stoisko: A 168
AGROMA S.A. w Poznaniu
Bogucin, ul. Gnieźnieńska 99
62-006 Kobylnica
tel.: +48 61 877 38 21
fax: +48 61 876 65 89
e-mail: [email protected]
www.agroma-poznan.pl
Ciągniki, maszyny rolnicze, części zamienne, ogumienie, akumulatory, pasy klinowe, filtry, oleje, łożyska,
pierścienie, uszczelniacze, silikony, narzędzia ręczne i
mechaniczne, art. BHP, elektrody, sznurki rolnicze, liny
polipropylenowe i stalowe, akcesoria do lin, siatka i folia
do pras zwijających, folia do owijania bel na sianokiszonki,
węże ciśnieniowe i asenizacyjne, oleje, smary, płyny motoryzacyjne, artykuły jeździeckie, modele – zabawki maszyn i
pojazdów rolniczych
Tractors, agricultural machines, spare parts, tyres, wet
batteries, wedge belts; filters, oils, bearings, rings, leak
stoppers, silicones, hand and mechanical tools, electrodes,
agricultural strings, polypropylene and steel cables, accessories for steel cables, net and plastic cover for roll balers;
bale wrapping plastic cover for hay – silage, pressure and
waste removal hoses, oils, greases, liquors motorization,
horse-riding articles, models–toys of agricultural machines.
Stoisko: A 171
AGROMAX s.c. Stanisław Osek, Tomasz Osek
Smugi 30
21-002 Jastków
tel./fax: +48 81 501 23 11
kom.: +48 501 025 412
e-mail: [email protected]
www.agromax.lublin.pl
Produkcja maszyn rolniczych: opryskiwaczy polowych
zawieszanych o pojemności 400, 600, 800, 1000, 1200,
1500 litrów z ręcznym lub hydraulicznym rozkładaniem
belki polowej; opryskiwaczy polowych przyczepianych o
pojemności 1500, 1800, 2000, 2500, 3000 litrów z belką
polową od 15 do 24 metrów; bron składanych hydraulicznie
4, 6 polowych; głęboszy 3, 5 zębowych; sadzarek do rozsady
2, 3, 4 rzędowych
Producer of agricultural machinery: mounted field sprayers
capacity of the tank 400, 600, 800, 1000, 1200, 1500 liters
with a beam spread manually or hydraulically; trailed field
sprayers capacity of the main tank 1500, 1800, 2000, 2500,
3000 liters with a beam from 15 to 24 m.; hydraulic folding
field harrows with 4, 6 field; subsoilers with 3, 5 tines; planters for seedlings with 2, 3, 4 rows
Stoisko: C 197
AGROMECHANIKA
ul. Kaliska 1/7
02-316 Warszawa
tel.: +48 22 822 03 34
fax: +48 22 822 66 49
e-mail: [email protected]
www.agromechanika.net.pl
Stoisko: B 29, B 373
AGROMARKET JARYSZKI
Jaryszki 4 k/Poznania
62-023 Gądki
tel.: +48 61 663 96 01
e-mail: [email protected]
www.agromarket.pl
AGROMARKET JARYSZKI jest firmą prowadzącą sprzedaż ciągników, kombajnów i ładowarek DEUTZ-FAHR oraz maszyn rolniczych czołowych producentów polskich i zagranicznych. Ponadto
oferujemy części zamienne i ogumienie do większości sprzętu
rolniczego. Zapewniamy serwis gwarancyjny i pogwarancyjny.
AGROMARKET JARYSZKI is a company which sells tractors,
combine harvesters and DEUTZ-FAHR loaders as well as
agriculture machines of top Polish and foreign manufacturers. Furthermore we offer spare parts and tyres for most
of agriculture equipment. We guarantee warranty and after
warranty service.
Stoisko: D 293
AGROMEHANIKA D.D.
4001 Kranj-Hrastje 52 a
p.p. 111 Slovenija
tel.: 0038 642 371 300
fax: 0038 642 371 303
e-mail: [email protected]
www.agromehanika.si
Od ponad 40 lat firma Agromehanika d.d. produkuje maszyny
rolnicze. Główna produkcja obejmuje wyroby wykorzystywane
do ochrony roślin, spryskiwacze i rozpylacze. Produkujemy
zarówno wyroby gotowe, jak i komponenty takie, jak pompy
czy sterowniki. Nasze linie wyrobów to maszyny dla małych
i większych gospodarstw, ponieważ oferujemy technologie
11
Spis wystawców
List of exhibitors
oprysków od 100 l aż do 3000 l. Inne nasze działania produkcyjne to ciągniki AGT o mocy od 25/60 KM, odpowiednie do
prac na polach położonych na terenach górskich i w służbach
komunalnych.
Company Agromehanika d.d. for more than 40 years
produces agricultural machinery. The main production are the
products used for plant protection, sprayers and mistblowers.
We manufacture finished products as well as components
such as pumps, controllers. Our product lines are machinery
for small farms and for larger farms, because we offer spray
technique from 100 l up to 3000 l. Other production activities
are tractors AGT from 25/60HP, that are suitable for work in
mountainous fields and municipal services.
hurcie i detalu. Zapraszamy sklepy detaliczne, handlowców
sprzętem rolniczym, importerów oraz klientów indywidualnych do sprawdzenia internetowego katalogu szyb i składania
zamówień. Szybka dostawa kurierem na terenie całego kraju.
SUPER CENY! DOSTAWA 24 h!
Stoisko: F 143
Agro-Mix
Wola Przedborska 19
97-570 Przedbórz
kontakt
Sobańki Mariusz +48 608 875 877 lub +48 44 781 52 53
Stoisko: C 595
Firma AGRO-MIX działa na rynku usług na potrzeby
rolnictwa od 14 lat. Dzięki wieloletniemu doświadczeniu
w produkcji przeznaczonej na usługi rolnictwa staliśmy
się firmą kompetentną i godną zaufania. Za główne atuty
naszej firmy uważamy trwałość, funkcjonalność i estetykę
naszych wyrobów. W swojej ofercie posiadamy: agregaty:
talerzowe, uprawowe podorywkowe, pługi i inne maszyny
dla rolnictwa.
AGROMET Produkcja Maszyn Rolniczych
Tomasz St. Matelski
Goryszewo 24
88-300 Mogilno
tel.: +48 52 315 83 87
tel./fax: +48 52 315 83 22
e-mail: [email protected]
www.agromet-mogilno.pl
Stoisko: A 13
Firma Agromet jest producentem wszelkiego rodzaju
urządzeń dla rolnictwa i nie tylko. Od początku istnienia
kładziemy bardzo duży nacisk na jakość oraz trwałość
naszych wyrobów. Wieloletnia współpraca z klientami oraz
partnerami handlowymi w Polsce i za granicą pozwoliła nam
na zdobycie doświadczenia, zrozumienie potrzeb klientów
oraz na wykorzystywanie tych doświadczeń przy projektowaniu nowych produktów. Produkujemy: osprzęt do ciągników i
ładowaczy czołowych, wyposażenie budynków i inwentarskich, wyposażenie pastwisk.
Przedsiębiorstwo Usługowo – Produkcyjne
Agromix Sp z o.o.
Rojęczyn 36
64-130 Rydzyna
tel.: +48 65 538 81 81, 65 538 81 67
tel./fax: +48 65 538 82 76
e-mail: [email protected]
www.agromix.agro.pl
Stoisko: A 263
The company Agromet is a manufacturer of various
equipment for agriculture and other areas. From the very
beginning we have put very strong emphasis on quality and
durability of our products. Long-term relationships with
our customers and trade partners in Poland and abroad
allowed us to gain experience and understand needs of our
customers, and to use that experience when designing new
products. We manufacture: - accessories for tractors and
front loaders; - equipment for livestock buildings; - pasture
equipment.
Stoisko: A 5
AGROMEX
Kolejowa 19
89-500 Tuchola
tel.: +48 52 334 34 06
kom.: +48 661 22 88 62
e-mail: [email protected]
www.e-szyby.pl, www.hurt.e-szyby.pl
SKLEP INTERNETOWY. Szyby do: ciągników, maszyn
rolniczych i budowlanych. Akcesoria do kabin. Sprzedaż w
12
AGROMOTOR Tadeusz Michalak
Ambrożew 54a
99-122 Góra św. Małgorzaty
tel./fax: +48 24 722 00 90
kom +48 603 93 65 70
Firma AGROMOTOR Tadeusz Michalak jest producentem
mieszadeł do gnojowicy: podrusztowych, slalomowych do
obiegu gnojowicy pod rusztem oborowym, zatapialnych do
zbiorników gnojowicowych otwartych z napędem elektrycznym. Jest producentem pomp do deszczowania z napędem
WOM, elektrycznym i agregatów pompowych spalinowych.
Wszystkie inwestycje realizujemy z montażem u klienta „pod
klucz”.
Agromotor Tadeusz Michalak is a producer of electric slurry
mixers that including: vertical paddle mixer, above ground
storage tanker mixer, submerged propeller mixer, we are also
producing pumps for agriculture: centrifugal single stage and
multi stage pumps trailer mounted, electric pumps (single
stage and multi stage) based on Caprari, Cadoppi trans-
A
mission, engine-driven pumps based on Caprari, Cadoppi
transmission. Our management team supports our clients
with best slurry and pumping knowledge on the market.
Stoisko: C 65
AGRONOMIK POLSKA Sp. z o.o.
Borów Wielki 57 E
67-124 Nowe Miasteczko
tel./fax: +48 68 388 89 40
e-mail: [email protected]
Sprzedaż maszyn do buraków, kukurydzy i ziemniaków firm
Agronomic, Amac, Irrimec. Pielniki, kombajny, sadzarki,
obsypniki, pryzmowniki, kosze, rozdrabniacze, deszczownie
szpulowe. Opryskiwacze polowe Caruelle i Matrot.
Sales and service for Agronomic Amac Irrimec and Caruelle,
Matrot. Potato planters, ridgers, harvesters, storage, equipments; inter-row cultivators for vegetable, sugar beets and
rape; irrigation equipments; sprayers.
Stoisko: C 192
AGROPLAST
22-107 Sawin
ul. Lubelska 24
tel.: +48 82 567 39 51
Jesteśmy firmą, która rozpoczęła swoją działalność w 1983
roku, produkcją części do opryskiwaczy polowych. Zdobyte w
tym czasie doświadczenie pozwala nam produkować szeroką
gamę wysokiej jakości podzespołów do opryskiwaczy i
innych maszyn rolniczych.
Stoisko: C 196
AgroSil Sp. z o.o.
ul. 1000 - lecia 5a
87-710 Służewo
tel./fax: +48 54 234 00 33
Zajmujemy się projektowaniem, budową i modernizacją magazynów zbożowych. Dzięki kilkunastoletniemu doświadczeniu w branży zbożowej, profesjonalnie pomagamy w doborze
i kompletacji urządzeń według indywidualnych potrzeb klienta.
Sprzedajemy: silosy zbożowe lejowe, płaskodenne, silosy
paszowe metalowe i z tworzywa sztucznego, przenośniki
kubełkowe, zgarniakowe, ślimakowe, taśmowe, rury spadowe, rozdzielacze, kolana, zasuwy, urządzenia do wstępnego
i dokładnego czyszczenia ziarna, konstrukcje wsporcze do
urządzeń.
Stoisko: C 389
Wydawca: Hortpress Sp. z o. o.
ul. Rakowiecka 32
02-532 Warszawa
tel.: +48 22 826 16 26
fax: +48 22 490 93 23
e-mail: [email protected]
www.hortpress.com
Agrotechnika (dawna Agrochemia). Miesięcznik poświęcony
uprawie roślin rolniczych. Publikuje artykuły doświadczonego
zespołu redakcyjnego oraz znanych i cenionych autorów,
dotyczące problemów nawożenia, ochrony i kompleksowej
uprawy poszczególnych gatunków roślin. Tematykę uzupełniają informacje dotyczące nowych rozwiązań technologicznych
i nowoczesnej mechanizacji wykonywania zabiegów w
produkcji polowej.
Stoisko: C55,C383
Przedsiębiorstwo Wielobranżowe „AGRO-RAMI”
Kościelna Wieś, ul. Poznańska 19
63-322 Gołuchów
tel.: +48 62 76 16 215
fax: +48 62 76-96-529
e-mail: [email protected]
www.agrorami.pl
AGRO-RAMI - wyłączny dystrybutor opon BKT w Polsce.
BKT – producent wysokiej jakości opon przeznaczonych
do motoryzacji, rolnictwa i leśnictwa, maszyn górniczych,
budowlanych, transportu wewnętrznego i wózków widłowych,
BKT posiada certyfikaty „ISO” oraz bezpieczeństwa.
AGRO-RAMI – Sole agent of BKT tyres in Poland. BKT – one
of the world’s leading manufacturers of “OFF – HIGHWAY
TYRES” for: agricultural tractors, trailers and implement tyres,
forklift tyres, industrial machinery, earthmoving equipment,
ATVs, lawn&garden equipment tyres. BKT obtained ISO
certifications.
Stoisko: C 47
agrotechnika – brudz
Wiesław Brudz
ul. Starobrzeska 24 b
49-300 Brzeg
tel.: +48 77 444 05 05
fax: +48 77 444 05 06
kom.: +48 510 073 762
e-mail: [email protected]
www.agrotechnika-brudz.pl
www.zaopatrzenie.rolnictwa.pl
Oferta firmy obejmuje: O.E.M. / MWS - noże do maszyn rolniczych, komunalnych i leśnych; GERINGHOFF - przystawki
do zbioru kukurydzy na ziarno, hedery zbożowe, serwis,
oryginalne części zamienne; JENSEN – rębaki do pni i gałęzi
drzew, serwis, oryginalne części zamienne; AGRI BROKER sita do kombajnów zbożowych; FLEXON / DONGHUA / IWIS
- łańcuchy do maszyn rolniczych; TAGEX / PIX / GATES/
STOMIL - pasy klinowe do maszyn rolniczych; FLETQUARD
/ WIX / DONALDSON - filtry ciągników i samobieżnych
13
Spis wystawców
List of exhibitors
maszyn rolniczych; CLAAS / JOHN DEERE / NEW HOLLAND
/ CASE / MENGELE - oryginalne części zamienne LEMKEN
/ KVERNELAND / FROST / KUHN / RABE / VOGEL & NOOT /
GREGOIRE BESSON / ÖVERUM - części uprawowe.
Stoisko: D 92
AGROTIMH Tomasz Iwaszkiewicz
Wilków Wielki 33
58-200 Niemcza - Wilków Wielki
tel./fax: +48 74 893 71 70
e-mail: [email protected]
www.agrotimh.pl
Jesteśmy producentem rozruszników z reduktorem i alternatorów znanych pod marką JOB‘s i JUBANA stosowanych w ciągnikach rolniczych typu MTZ, URSUS, ZETOR, MF, PERKINS,
a także innych maszynach rolniczych i budowlanych. Nasza
firma jest także producentem oraz dystrybutorem zestawów
naprawczych, wałów korbowych, systemów paliwowych,
kół zębatych i wałków oraz innych części stosowanych w
ciągnikach MTZ i pochodnych. Dostarczamy także bogaty
asortyment wysokiej jakości łączników centralnych, kul,
zawleczek i sworzni mających zastosowanie we wszystkich
powszechnie znanych maszynach i ciągnikach rolniczych.
Stoisko: D 215
AGROTOP-KACZMAREK
Niedźwiedź 1B
63-500 Ostrzeszów
tel.: +48 62 732 09 30
fax: +48 62 732 09 34
Sprzedaż: +48 516 082 188, 506 069 727, 501 377 119
Serwis: +48 508 328 877, Magazyn: 506 094 813
e-mail: [email protected]
www.agrotop.com.pl
www.sator-europe.eu
www.agrotopparts.pl
Działamy na rynku maszyn od 1997 roku. Dzięki szerokiej
gamie maszyn znaczących, światowych producentów
staliśmy się liderem na polskim rynku maszyn do warzywnictwa i rolnictwa. Nowością naszej firmy są kombajny,
obsypniki, kopaczki do warzyw marki SATOR. Serwis to nasza
najmocniejsza strona. Z każdym dniem dążymy do osiągnięcia
wyższego poziomu obsługi klienta. Posiadamy również bogaty
magazyn części zamiennych.
AGROTOP-KACZMAREK has been in the agricultural machinery market since 1997. We have managed to become a leader
in the Polish market of vegetables and agriculture thanks to
our cooperation with a wide range of top-class world producers. Harvesters, cultivators and lifters for vegetables are new
products from the range of our brand – SATOR. Our greatest
advantage is our service. We improve our customer service
every day as well. What is more, our warehouse offers all
necessary spare parts.
Stoisko: C 283
We are manufacturer of starters with speed reducer and
alternators under the brand names JOB’s and JUBANA for
MTZ, URSUS, ZETOR, MF, PERKINS and other agricultural
and construction machinery. Our company also manufactures
and sales cylinder kits, crankshafts, fuel systems, gears,
shafts and many others parts for MTZ. Large assortment of
top link assemblies and connectors for various agricultural
machineries.
Stoisko: hala 36
Przedsiębiorstwo Wielofunkcyjne AGROUNIMA
Cezary Sztuder
ul. Ks. Ściegiennego 2
63-700 Krotoszyn
tel.: +48 62 725 77 88
kom.: +48 602 102 942
Przedsiębiorstwo działa od 1992 roku. Działalność firmy
obejmuje: produkcję maszyn i urządzeń rolniczych, produkcję
konstrukcji stalowych, obróbkę mechaniczna i plastyczną, działalność handlową. Prezentowany na wystawie usuwacz obornika
przeznaczony jest do zmechanizowanego usuwania obornika z
budynków inwentarskich. Wykonane przez nas maszyny i urządzenia posiadają certyfikat CE. NOWOŚĆ! Punktowy osuszacz
ziarna zbóż – umożliwia obniżenie poziomu wilgotności z 18% do
11%-12,5%, przeznaczony do dosuszania ziarna zbóż i innych
roślin uprawnych: traw, kwiatów, roślin ozdobnych.
Stoisko: D 429
AgroYoumis PL Sp. z o.o.
Skórzewo, ul. Poznańska 80
60-185 Poznań
tel.: 61 862 87 84
e-mail: [email protected]
www.agroyoumis.eu
Stoisko: B 368
AGROTRADE Ostrowski Grzegorz
ul. Tęczowa 10, 21-200 Parczew,
tel./fax: +48 83 3550790
e-mail: [email protected]
www.agrotrade.biz.pl
UAB “JUBANA”
Gamyklos str. 45, Mazeikiai LT-89110
Lithuania
tel./fax: +370 443 67306, 65152
e-mail: [email protected]
www.jubana.eu
14
AJDAR Sp. z o.o.
Augustowo 6
86-022 Dobcz
tel.: +48 52 364 96 07 w 43
fax: +48 52 364 96 08
e-mail: [email protected]
www.ajdar.eu
Stoisko: F 490
A
akf leasing
polska
AKF Leasing Polska
Al. Armii Ludowej 26
00-609 Warszawa
tel.: +48 22 417 83 77
fax: +48 22 417 83 78
e-mail: [email protected]
www.akf-polska.pl
Biuro Techniczne BOTT
ul. Budowlanych 1
64-100 Leszno
tel./fax: +48 65 529 48 08
kom.: +48 508 799 029
e-mail: [email protected]
www.bott.pl
Od ponad czterdziestu lat działamy na rynku europejskim jako
solidny partner finansowy dla małych i średnich przedsiębiorstw oraz gospodarstw rolnych. Oprócz wiedzy fachowej
czy też indywidualnych rozwiązań finansowych oferujemy
pomoc specjalistów znających branżowe wymogi klientów – w
szczególności z zakresu rolnictwa i agrotechniki. Jako finansujący, który pomaga, postępuje racjonalnie i jako partner ponosi
część odpowiedzialności za decyzje, stanowimy właściwe
uzupełnienie dla banków obsługujących naszych Klientów.
Wszystkim Klientom oferujemy: udział własny od 0%; okres
finansowania do 84 mc; finansowanie podatku VAT; raty sezonowe; raty kwartalne i półroczne. Współpraca z największymi
sieciami dilerskimi sprzętu rolniczego daje naszym Klientom
gwarancję bezpiecznej i atrakcyjnej ofertowo transakcji.
Stoisko: D 411
Rozpylacze ceramiczne ALBUZ promuje firma BOTT Agro.
Marka ALBUZ zyskuje ogromną popularność dzięki 10-krotnie wyższej wytrzymałości w porównaniu z produktami
z tworzywa sztucznego i metalu, a także dobrej cenie.
Inwestycja w te rozpylacze zwraca się już po kilkunastu
opryskach, dając oszczędności ś.o.r. Sadownicy na całym
świecie sięgają po model TVI - ceramiczny eżektor wirowy,
natomiast w uprawach polowych bezkonkurencyjny jest AVI
TWIN – ceramiczny eżektor dwustrumieniowy. Ceny: 12 - 44
zł brutto.
ALBUZ ceramic nozzles have been introduced to Polish market
by BOTT Agro. ALBUZ is becoming popular due to its durability up to 10,000 ha and attractive price. All over the world
orcharders choose TVI - ceramic anti-drift hollow cone nozzle,
however AVI TWIN - ceramic anti-drift nozzle with two streams
are uncompetitive in field tillage. Prices: 12 - 44 zł brutto.
Stoisko: C 63
Akpil Producent Maszyn Rolniczych
ul. Witosa 11 i 21
39-220 Pilzno
tel.: +48 14 672 25 51
tel./fax: +48 14 672 25 50
e-mail: [email protected]
www.akpil.pl
Akpil producent maszyn rolniczych. Oferujemy: Agregaty
talerzowe, uprawowe, podorywkowe; Brony ciągnione,
wirnikowe, zawieszane; Dmuchawy śnieżne i pługi; Glebogryzarki; Kombajn ziemniaczany; Kopaczki; Kosiarki rotacyjne.
dyskowe; Opryskiwacze; Pielniki aktywne; Pielniko-obsypniki;
Pługi; jednobelkowe, obracalne, zagonowe; Przetrząsarki;
Rozsiewacze; Sadzarki; Zgrabiarki.
Akpil manufacturer of agricultural machines. We offer: Disk
units a; Cultivation units; Drag harrows; Rotary harrows;
Suspended harrows; Snow blowers; Soil millers; Potato
harvesters; Potato diggers; Rotary grass mowers; Spraying
machines; Active hoes; Hoes – ridging ploughs; Single furrow ploughs; Swivel ploughs; Bed ploughs; Hay tedders;
Distributors; Planters; Rakes.
ALFA USZCZELNIENIA TECHNICZNE
ul. Kostrogaj 9
909-400 Płock
tel.: +48 24 264 48 01
fax: +48 24 267 39 57
e-mail: [email protected]
www.alfa-pl.com
W ofercie: pierścienie uszczelniające do hydrauliki siłowej i
pneumatyki, simmeringi, oringi, sznury oringowe, szczeliwa,
płyty bezazbestowe, podkładki, pierścienie "segera", opaski,
obejmy, płytki osadcze. Kleje, płynne uszczelnienia i smary
LOCTITE i Teroson.
The offer includes: sealing rings for hydraulics and pneumatic
systems, radial shaft seals, O-rings, O-ring strings, sealants,
asbestos-free panels, washers, Seeger rings, bands, clasps,
mounting plates. LOCTITE and Teroson adhesives, liquid
sealings and lubricants.
Stoisko: C 75
Stoisko: A 174
Aktualności Wydawnictwo Targowe Małgorzata
Lamenta-Przybylska
61-612 Rubież 10R
tel.: +48 61 664 70 00
fax: +48 61 664 70 01
e-mail: [email protected]
Stoisko: hala 2
ALFAPANEL INVEST Sp. z o.o.
63-100 Śrem
ul. Nadbrzeżna 1B/4
tel.: +48 65 619 43 04
kom.: +48 506 060 819
www.alfapanel.pl
15
Spis wystawców
List of exhibitors
Nadrzędnym celem działań firmy ALFAPANEL INVEST jest
kompleksowa obsługa Klienta poprzez dostarczenie Jemu rozwiązań w oparciu o technologię konstrukcji stalowych i lekkiej
obudowy na bazie płyt warstwowych, blach trapezowych i
płyt izolacyjnych. Zapraszamy do współpracy!
paszowe. Wozy asenizacyjne. Rozrzutniki obornika i wapna.
Wyposażenie obór. Środki myjąco – dezynfekujące.
The principal aim of the company ALFAPANEL INVEST activity
is the comprehensive Customers service by means of supplying them with solutions on the basis of technology of steel
constructions and light building up on the base of stratified
boards, trapezium metal sheets and isulating boards.
Milking equipment and machines: milking parlours. Automatic
milking system. Computerized herd management system:
measurment of milk production system and identyfication cows,
automatic cows heat detection system, cows segregation
system, cows weighing system, marking system, automatic
feeding system, station for cow-baby feeding, milk cooling and
collecting system. Mixing wagons. Cisterns for waste removal.
Cow-house equipment. Resources for cleaning and disinfection.
Stoisko: F 479
Stoisko: D 221
Zakład Handlowo - Produkcyjno - Usługowy "ALICJA"
Henryk Gębala
ul. Gdańska 26
86-170 Nowe
tel.: +48 58 535 15 96, 332 75 75
fax: +48 52 562 56 63
kom.: +48 601 657 168 - Henryk Gębala
kom.: +48 601 193 777 - Krzysztof Gębala
e-mail: [email protected]
www.garazyki.pl
Jedyny w Polsce północnej producent garaży blaszanych oraz
konstrukcji typu: hale, ogrodzenia budowlane (ocynkowane,
powlekane), wiaty śmietnikowe, kontenery magazynowo-budowlane, kioski, stróżówki. Produkcja obejmuje ponadto
bramy garażowe (ocieplane, nieocieplane) oraz blachy płaskie
w bogatej palecie kolorystycznej i blachy trapezowe cechujące się trwałością i wysoką odpornością na korozję.
Zapewniamy gwarancję na oferowane produkty.
Only one manufacturer of metal garages and steel construction in northern Poland. We manufacture metal garages, shelters and halls, construction fencings( galvanized and coated
sheets ), containers ( metal and insulated with styrofoam ),
garage doors and many other constructions. Full range of on
site: www.garazyki.pl
Stoisko: C 532
Alois POETTINGER Maschinenfabrik GmbH
Industriegelaende 1
4710 Grieskirchen, Austria
tel.: +43 724 86 00
fax: +43 724 860 05 13
Przedstawiciel w Polsce:
Juliusz Tyrakowski
ul. Skawińska 22
61-333 Poznań
tel.: +48 61 870 05 55
fax: +48 61 887 00 46
Poettinger Maschinenfabrik GmbH z siedzibą w Grieskirchen
to największy austriacki producent maszyn rolniczych.
Światowy leader w produkcji przyczep samozbierających. W
ofercie: przyczepy samozbierające, kosiarki, przetrząsacze,
zgrabiarki, sieczkarnie do kukurydzy, pługi, brony wirnikowe,
siewniki mechaniczne i pneumatyczne, siewniki do siewu
mulczowego, kultywatory i brony talerzowe.
Poettinger Maschinenfabrik GmbH with its seat in Grieskirchen
ist the largest Austrian manufacturer of agricultural machinery.
Poettinger is the world’s leader in the production of self-loading trailers. The offer incudes self-loading trailers, mowers,
tedders, windrowers, corn cutters, ploughs, rotary harrows,
mechanical and pneumatic drills, mulching drills, stubble
ciltivators and short disc harrows.
Stoisko: C 281
P.P.H.U. „A-LIMA-BIS” Sp. z o.o.
ul. 27 Grudnia 5
63-000 Środa Wielkopolska;
tel.: +48 61 28 538 61
fax: +48 61 28 669 60
e-mail: [email protected]
www.alimabis.com.pl
Systemy udojowe. Roboty udojowe. Komputerowe systemy
zarządzania stadem: pomiaru mleka, identyfikacji krów,
automatycznego wykrywania rui, separacji krów, ważenia
krów, indywidualnego żywienia krów, stacje odpajania
cieląt. Systemy schładzania i magazynowania mleka. Wozy
16
Altro Firma Produkcyjno-Handlowa
Skibno 70
76-004 Sianów
tel./fax: +48 94 318 50 45
e-mail: [email protected]
www.altro.agro.pl
Stoisko: C 72
AMA Shanghai
Rm 2019 Fortune Times, No.1438
North Shaanxi Rd., Shanghai 200060
Chiny
tel.: +86 21 517 80 125
fax: +86 21 517 80 126
e-mail: [email protected]
www.ama-shanghai.com
Stoisko: hala 37
A
wy, masywny z dużym momentem obrotowym ciągnik już
od 117 KM. Seria7 teraz jeszcze bardziej oszczędna, już z
addblue!
Aman Janusz Młynarczyk
ul. Przemysłowa 1d
89-110 Sadki
tel.: +48 660 797 779
fax: +48 52 385 03 61
e-mail: [email protected]
www.firma-aman.pl
Stoisko: C 509
Amazonen-Werke H. Dreyer GmbH+Co. KG.
Postfach 51
49 202 Hasbergen – Gaste,Niemcy
tel.: +49 540 501 0
fax: +49 540 55 01 147
e-mail: [email protected]
www.amazone.de
AMG Sp. zo.o. is the sole importer of LANDINI tractors in
Poland. This is where you find one of the best tractors in
the market! Best known Landini tractors? Mistral, best for
orchards, vineyards and/or municipal areas maintenance;
available in 35-54 HP range. Rex, also known as the orchard
king, available in the HP range of 68-120. ALPINE best for row
crops. POWERFARM HC tractor with high clearence up to 70
cm. 5H stands for the series of highly economical tractors,
perfect in combination with a loader. Landpower equipped
with 6-cylinder turbo engine, is a powerful tractor with HP
starting at 117. Series7 now even more economical, available
with addblue system!
Stoisko: B 270
Firma Amazone powstała w 1883 r. Grupa Amazone
posiada osiem zakładów produkcyjnych, z załogą ok 1700
pracowników: maszyny rolnicze do uprawy gleby, siewu,
nawożenia oraz ochrony roślin, maszyny komunalne do pielęgnacji powierzchni zielonych oraz zabezpieczenia w okresie
zimowym. Od czasu powstania firmy Amazone wprowadzała
wyróżniające się pionierskie rozwiązania. Łącznie 26 medali
na ostatnich 8 targach AGRITECHNIKA wskazują na wysoką
pozycję Amazone we wprowadzaniu postępu.
AMI Sp. z o.o. S.K.A.
ul. Stara Droga 1
63-510 Mikstat
Sekretariat: tel./fax: +48 62 731 08 00
e-mail: [email protected]
Dział Kontraktacji: tel.: +48 62 731 05 80
e-mail: [email protected]
www.ami.com.pl
Firma Amazone ist im Jahre 1883. Die Amazone – Gruppe
produziert an acht Standorten mit 1700 Mitarbeitern: Landmaschinen für die Bodenbearbeitung, Saat, Düngung und den
Pflanzenschutz, Kommunalmaschinen für die Grünflächenpflege und den Winterdienst. Seit der Gründung der Firma wurden
bei Amazone ständig hervorragende Pionierleistungen und
Innovationnen hervorgebracht. Insgesamt 26 Medaillien bei
den acht AGRITECHNIKA – Ausstellungen weisen auf die hohe
Innovationskraft der Amazone – Gruppe hin.
Zapraszamy hodowców kaczek i gęsi zainteresowanych
współpracą na zasadzie umów kontraktacyjnych. Jesteśmy
największym w kraju producentem gęsi i kaczek. Posiadamy
własny zakład uboju drobiu. Naszym hodowcom gwarantujemy: sprzedaż piskląt gęsich, kaczych i kurzych oraz
ich bezpłatny dowóz specjalistycznym transportem, pełen
program szczepień profilaktycznych, fachowe doradztwo
zootechniczne i weterynaryjne. Atrakcyjne warunki stałej
współpracy.
Stoisko: F 305
AMG Sp. z o. o.
ul. Tomaszowska 36
96-200 Rawa Mazowiecka
tel.: +48 46 815 15 10
fax: +48 46 814 66 77
www.landini.info.pl
AMG Sp. zo.o. to wyłączny importer ciągników marki
LANDINI w Polsce. To właśnie u nas znajdziesz jedne z
najlepszych ciągników na rynku! Najbardziej znane modele
Landini? Mistral ciągnik sadowniczo-komunalny, o zakresie
mocy od 35 do 54 KM. Rex, zwany też królem sadu, w
przedziale mocy 68 - 120 KM. ALPINE - najlepszy ciągnik
do upraw warzywniczych ! POWERFARM HC - Ciągnik z
wysokim prześwitem. 5H to seria oszczędnych ciągników,
idealnych do pracy z ładowaczem. Landpower 6-cylindro-
We are looking for ducks and geese breeders interested
in cooperation under breeding contracts. We are the
largest producer of geese and ducks in Poland, with its
own poultry abattoir. For our breeders we guarantee: sale
of goslings, ducklings and chicks and their free delivery
using a specialist transport, a complete preventive
vaccination programme, and professional zootechnical and
veterinary counselling. Attractive conditions for permanent
cooperation.
Stoisko: A 264
Anderwald Maszyny Rolnicze
ul. Dworcowa 45
47-175 Kadłub
tel.: +48 77 463 37 70
fax: +48 77 463 37 71
e-mail: [email protected]
www.anderwald.pl
Stoisko: A 4
17
Spis wystawców
List of exhibitors
ANWIL S.A. is one of the biggest Polish producers of nitrogen
fertilizers. The company produces ammonium nitrate,
CANWIL with magnesium and CANWIL S with sulphur. The
quality of fertilizers produced by ANWIL S.A. was aproved by
the certificate of Q quality awarded by Polskie Centrum Badań
i Certyfikacji.
ANDERAS STIHL Spółka z o.o.
ul. Poznańska 16
62-080 Sady
tel.: +48 61 816 62 00
fax: +48 61 816 62 02
e-mail: [email protected]
www.stihl.pl
Stoisko: A 323
Stoisko: F 254
Annaburger Polska Sp. z o.o.
ul. Otuska 47
64-320 Wielkawieś
tel.: +48 60 721 01 90
www.annaburger-polska.pl
Stoisko: E 581
APH Group Polska Sp. z o.o.
Piekiełko 25
76-200 Słupsk
tel.: +48 509 049 995, 600 498 075
e-mail: [email protected]
www.aph.nl
Stoisko: C 524
ANTINUS Sp. z o.o.
ul. Sobieskiego 39 B5
96-100 Skierniewice
tel.: +48 46 831 00 22
kom.: +48 600 254 255
e-mail: [email protected]
www.eko-watt.pl
APV Polska
ul. Cecorska 9
76-200 Słupsk
tel./fax: +48 59 841 41 93
tel.: +48 793 304 101
e-mail: [email protected]
www.apv-polska.pl
Jesteśmy firmą działającą w branży instalacyjnej w zakresie
wykorzystania odnawialnych źródeł energii. Produkty oferowane
przez firmę pod marką EKO-WATT wyróżnia wysoka jakość i
niezawodność oraz korzystna cena. Podstawowym celem firmy
jest zapewnienie inwestorowi kompleksowej usługi, począwszy
od doradztwa technicznego i finansowego, poprzez projektowanie i dostarczenie wysokiej jakości produktu, do profesjonalnego
montażu i serwisu.
APV POLSKA – przedstawicielstwo austriackiej firmy APV Technische Produkte Ges.m.b.H. APV to producent wysokiej jakości
elektrycznych rozsiewaczy tarczowych i pneumatycznych do
poplonów, traw, środków ślimakobójczych, nawozów i mikrogranulatów. Firma produkuje również profesjonalne maszyny do
pielęgnacji i podsiewu użytków zielonych, a także rozsiewacze
wykonane ze stali nierdzewnej do użytku zimowego.
Antinus Ltd. is one of the a market leaders in installation
and systems integration of renewable energy resources in
Poland. We offer an array of energy saving solutions to our
customers such as solar systems for heating up hot water,
photovoltaic products as well as heat pumps. We take pride in
our commitment to a higher standard of quality and customer
satisfaction.
Stoisko: F 480
ANWIL S.A.
ul. Toruńska 222
87-805 Włocławek
tel.: +48 54 237 30 38
fax: +48 54 237 33 13
e-mail: [email protected]
www.anwil.pl
ANWIL S.A. jest jednym z największych producentów nawozów
azotowych w Polsce. Produkuje saletrę amonową, CANWIL z
magnezem oraz CANWIL S z siarką. Nawozy oferowane przez
ANWIL S.A. posiadają certyfikat najwyższej jakości Q nadany
przez Polskie Centrum Badań i Certyfikacji w Pile.
18
Stoisko: B 37
AQUA-ROL Sp. z o.o
ul. Tuszyńska 13
97-318 Czarnocin
tel./fax: +48 44 616 53 30
kom.: +48 608 54 80 54, 668 425 424, 604 57 61 27
e-mail: [email protected]
www.aqua-rol.pl
Wyłączny importer deszczowni szpulowych firmy OCMIS(Włochy): deszczownie szpulowe, belki zraszające, zraszacze Sime,
pompy do wody Ocmis, Rovatti, spalinowe agregaty pompowe
SCOVA, Rury PE i PCV-U do przesyłu wody i PE na deszczownie, złączki, hydranty Scova. Sprzedaż, kredyty, leasing, serwis,
części zamienne. Najwyższa jakość, nowoczesne technologie.
The exclusive importer of irrigators machines from OCMIS
Irrigazione SPA(Italy): hose reel irrigators, spray booms,
rainguns Sime, pumps for water Ocmis, Rovatti, motorpumps
from SCOVA. The PE and PCV-U tubes for deliver water and for
the irrigators reels, joints and hydrants valve. The sale, credits,
leasing, service, spare parts. First-class performance, advanced
technology.
Stoisko: C 70
A
Przedsiębiostwo Produkcyjno-Wdrożeniowe
„ARAJ” Sp. z o.o.
Mireckiego 30
55-080 Kąty Wrocławskie
tel.: +48 71 391 31 31
fax: +48 71 391 31 37
e-mail: [email protected]
www.araj.pl
Stoisko: C 276
P.P.H.U. „ARETE”
Czesław Klejbuk
Osiedle Centrum 17
16-100 Sokółka
tel./fax: +48 85 711 56 58
e-mail: [email protected]
www.aretesokolka.pl
paszowe dla zwierząt hodowlanych. Naszą domeną jest bardzo
wysoka jakość produktów, które zostały pozyskane w oparciu
o najnowsze osiągnięcia biotechnologii, wsparcie placówek
naukowych oraz własne innowacyjne rozwiązania. Zapraszamy
do współpracy.
Our experience in the feed, fertilizer and chemical sectors has
been building since 1992. We produce feed additives, fertilizers
and compounds with a focus on extracting the best from nature.
For this reason, in our offers you will find a wide range of
products based on the latest developments of biotechnology, in
particular high-class chelates. Many years of cooperation with
scientific institutions and universities have resulted in proven and
effective products. We invite you to cooperation.
Stoisko: A 321
Producent elektroniki dla rolnictwa i przemysłu: Liczniki
owijarek bel, sterowniki pras belujących, sterowniki przyczep
samozbierających itp. Uniwersalne panele kontrolne do maszyn
rolniczych, panele GPS dla rolnictwa. Produkcja elektroniki według indywidualnej specyfikacji producentów maszyn rolniczych.
Szafy sterownicze, automatyzacja procesów technologicznych.
Wyłączna dystrybucja oraz serwis systemów wagowych firmy
PTM srl..
A producer of electronic systems for agriculture and industry:
bale wrapper counters, controllers for harvesting trailers, etc.
Universal control panels for agricultural machines, GPS panels
for agriculture. Production of electronic systems to a customized
specification of agricultural machine producers. Control
cabinets, automation of technological processes. Undivided
distribution and service for weighing systems PTM srl company.
Stoisko: F 145
Przedsiębiorstwo Wielobranżowe
ARIKON-agro
ul. Jackowskiego 27
63-000 Środa Wlkp.
tel.: +48 61 285 45 41
fax: +48 61 285 45 41
e-mail: [email protected]
www.arikon.com.pl
Arkus Jacek Kowalczyk
Jasin, ul. Wrzesińska 87
62-020 Swarzędz
tel.: +48 61 818 16 39
fax: +48 61 818 16 28
e-mail: [email protected]
www.arkus.poznan.pl
Dostarczamy urządzenia do transferu płynów (np.: masy gęste,
kleje, aplikacja farb i lakierów) oraz elementy hydrauliki siłowej,
w tym: przewody hydrauliczne (węże EXITFLEX, SEMPERIT, SEL
- zakuwane na miejscu), szybkozłącza i armaturę (końcówki,
zawory itp.). Zapraszamy do współpracy przedstawicieli wszystkich gałęzi przemysłu, rzemiosła i usług.
We deliver proffesional systems for: liquids transfer, supply systems, finishing units–painting, also we are producer of hydraulic
hose assemblies, wide range of fittings according to customer
specifications all based on high quality hoses like: EXITFLEX,
SEMPERIT, SEL. We would like to invite all sales represetatives
to cooperate.
Stoisko: hala 32
Stoisko: C 516
Przedsiębiorstwo Arkop sp. z o.o
ul. Kolejowa 34a
32-332 Bukowno
tel.: +48 32 649 44 50
fax: +48 32 649 44 51
Swoje doświadczenie w sektorze rolniczym budujemy od 1992
roku. Produkujemy nawozy oraz dodatki paszowe, których
celem jest wydobycie z natury tego, co najlepsze. W naszej
ofercie znajdą Państwo szeroką gamę nawozów dolistnych
dedykowanych pod uprawy rolnicze i ogrodnicze oraz dodatki
ARMASZ Arkadiusz Leciejewski
Łąkta 5
63-900 Rawicz
tel.: +48 723 179 158, 609 582 622
e-mail: [email protected]
www.armasz.pl
Firma ARMASZ jest producentem maszyn rolniczych. Oferujmy
agregaty uprawowo-siewne i agregaty uprawowo-siewne z
hydropakiem o szer. roboczej 2,5m, 2,7m, 3,0m, agregaty
ścierniskowe o szer. roboczej 2,2m, 2,5m, 3,0m i siewniki
poplonu sterowane z kabiny ciągnika. Udzielamy 12-miesięcznej
gwarancji. Dysponujemy własnym transportem, prowadzimy
sprzedaż ratalną.
The company ARMASZ manufacturers agricultural machines.
We offer cultivation and sowing units, and cultivation and sowing units with hydropack of 2.5 m, 2.7 m, and 3.0 m working
19
Spis wystawców
List of exhibitors
width, stubble cultivators of 2.2 m, 2.5 m, and 3.0 m working
width, and after-crop sowers controlled from a tractor cabin. We
grant a 12-months guarantee. We offer own transport and hire
purchase.
Stoisko: A 15
ART-GUM Sp. z o.o.
Mazańcowice 57
43-391 Mazańcowice
tel.: +48 33 815 66 05
fax: +48 33 815 66 06
e-mail: [email protected]
www.artgum.com.pl
Stoisko: E 129
Stoisko: E 119
AUTO-TRANS MARCIN PASIKOWSKI
09-500 Leśniewice 54
tel.: +48 695 838 823
e-mail: [email protected]
www.atmp.pl
Stoisko: E 448
ATMP to dynamicznie rozwijająca się firma międzynarodowa,
z siedzibą w Gostyninie w województwie mazowieckim. Jesteśmy producentem maszyn rolniczych własnej konstrukcji oraz
pługów śnieżnych. Wysoka jakość i niezawodność maszyn
gwarantuje nowoczesny park maszynowy z obrabiarkami
CNC. Wszystkie maszyny firmy spełniają wymagania Dyrektywy Maszynowej i posiadają deklaracje zgodności CE. www.
atmp.pl.
ASAT International Sp. z o.o.
ul. Roślinna 12a/1
61-307 Poznań
tel.: +48 61 870 57 50
fax: +48 61 887 66 65
e-mail: [email protected]
ATK-Retreads Polska
ul. Poznańska 1
62-005 Bolechowo
e-mail: [email protected]
Operator: +48 61 812 60 17
Administration: +48 61 812 61 60
Sale Department: +48 61 812 61 02
fax: +48 61 812 62 10
Sales representatives
North of Poland
Paweł Włodarczyk
kom.: +48 696 822 545
e-mail: [email protected]
South of Poland
Bartosz Szczepański
kom.: +48 696 824 882
e-mail: [email protected]
ATK-Retreads Polska to firma zajmująca się bieżnikowaniem
opon. Siedzibą ATK-Retreads Polska jest Bolechowo koło
Poznania. Bolechowo to miejscowość, w której bieżnikowanie
opon samochodowych prowadzone jest nieprzerwanie od
ponad 65 lat. W ATK-Retreads Polska zatrudnionych jest ponad 100 pracowników z dużym doświadczeniem, niezbędnym
dla utrzymania wysokiego poziomu jakości produkcji i usług.
Ciągle unowocześniany park maszynowy i poszerzana gama
produkowanych wyrobów zapewniają konkurencyjność oferty
handlowej. ATK-Retreads Polska zajmuje się recyklingiem zużytych opon samochodowych oraz skupem opon ciężarowych
do bieżnikowania. W celu składania zamówień lub zapytań
indywidualnych prosimy o kontakt na [email protected]
lub telefonicznie 61 812 61 02 (fax 61 812 62 10). Serdecznie
zapraszamy na nasze stoisko.
ATK-Retreads Poland is a well known producer of retreaded
tires. Our Company is located in Bolechowo nearby Poznań.
Bolechowo is a village where tire retreading is conducted
continuously for over 65 years. ATK-Retreads Poland employs
over 100 employees with extensive experience, necessary
to maintain a high level of products and services quality.
Continuously modernized machine park and extended range of
20
our products provide competitive offer. ATK-Retreads Poland
recycles used car tires and buys truck tires for retreading. To
place an order or an inquiry please write to [email protected] or call 61 812 61 02 (fax 61 812 62 10). We would like
to invite you to visit our stand.
ATMP is a dynamically developing company international, with
registered office in Gostynin in the Mazovian province. We are
a producer of agricultural machines of the own structure and
snowploughs.The best quality and the reliability of machines
are guaranteeing modern machines with CNC machine tools.
All machines of the company are meeting requirements of
the Machine Directive and CE agreements have declarations.
www.atmp.pl.
Stoisko: A 12
atr express
Boomgaarden Medien Sp. z o.o.
Ruszków Drugi, ul. Wesoła 52
62-604 Kościelec
tel.: +48 63 261 60 83
fax: +48 63 272 54 17
e-mail: [email protected]
www.atrexpress.com.pl
atr express jest najbardziej aktualnym dwutygodnikiem branżowym, adresowanym przede wszystkim do producentów,
importerów, dealerów maszyn rolniczych i ogrodniczych, firm
świadczących usługi oraz gospodarstw rolnych powyżej
40 ha, gospodarstw warzywniczych i sadowniczych.
atr express is one of the most up-to-date fortnighttly trade magazine; its addressed to the manufacturers, dealers, representatives and importers of agricultural, gardening, firms making
agricultural services and farms Langer than 40 hectares.
Stoisko: B 270
A
covers the whole country. We export our products to 21
countries in Europe, Asia and Africa. We sell wholesale and
retail. AUTOPART brand batteries are popular and have high
reputation among customers who appreciate their high quality
and, good performance.
ATW S.A.
ul. Bieszczadzka 5
38-540 Zagórz
tel.: +48 13 468 93 33
fax: +48 13 468 93 68
e-mail: [email protected]
www.atwsystem.pl
Stoisko: D 97
"ATW posiada gamę produktów bardzo zaawansowanych
technologicznie od osi o nośności 500 kg do 16 ton.
Wszystkie osie hamowane posiadają certyfikat (homologację)
TUV, począwszy od 30 km / h do 105 kilometrów na godzinę.
Oferujemy również osi skrętne z opatentowanymi przez grupę
ADR rozwiązaniami technologicznymi. ATW produkuje również
zawieszenia pojedyncze, tandem, tridem – na resorach
parabolicznych jak również zawieszania pneumatyczne i
hydrauliczne."
„ATW possesses a range of very much technologically
advanced products from axles with the capacity of 500 kg to
16-ton-capacity axles with brakes certification valid within
entire Europe, ranging from 30 km/h to 105 km/h. We also
offer steering axles with technological solutions patented in
cooperation with ADR. ATW produces also single- double- and
even triple-axle suspensions – parabolic spring and pneumatic
also hyfraulic ones.”
Stoisko: E 226
AUTOPART S.A.
ul. Kwiatkowskiego 2a
39-300 Mielec
tel.: +48 17 584 57 00
fax: +48 17 788 72 12
e-mail: [email protected]
www.autopart.pl
Oferujemy akumulatory rozruchowe przeznaczone do
samochodów osobowych, ciężarowych, ciągników i maszyn
rolniczych. W sprzedaży również akumulatory semi-traction.
Wysoka jakość wyrobów potwierdzona Certyfikatami Systemów Zarządzania Jakością ISO 9001:2008, ISO/TS 16949
oraz Ochroną Środowiska ISO 14001. Posiadamy szeroko
rozbudowaną sieć dystrybucji, która swym zakresem działania
obejmuje obszar całego kraju. Eksportujemy swoje produkty
do 21 krajów Europy, Azji i Afryki. Prowadzimy sprzedaż
hurtową i detaliczną. Akumulatory marki AUTOPART cieszą
się zainteresowaniem i dużą renomą wśród klientów, którzy
cenią ich wysoką jakość i dobre parametry użytkowe.
We offer a starter batteries for cars, trucks, tractors and
agricultural machines. We sale the semi-traction batteries as
well. High quality of products is confirmed by Certificates
of Quality Management Systems ISO 9001:2008, ISO / TS
16949 and ISO 14001 Environmental Protection. We have an
extensive distribution network, which in its scope of action
Auto-Tech Nieskórski Robert
ul. Przemysłowa 1
07-407 Czerwin
fax: +48 29 645 91 08
kom.: +48 606 394 243
e-mail: [email protected]
Firma Auto-Tech wyspecjalizowana jest w produkcji
przyczep rolniczych, burtowych, platform, przyczep
specjalistycznych, objętościowych i kontenerów hakowych,
konstrukcje stalowe hal, wiat i garaży. Stalowe wygrodzenia
obór dla bydła i trzody.
Description of the company: Auto-Tech company specializes
in production of agricultural trailers, air-bornes, platforms,
clinch socialistic, bulk and hooks containers, steel constructions of rooms, breezeways and garages. Steel railing of
cowsheds for cattle and flock.
Stoisko: F 244
AVANT POLSKA – dział firmy:
SERAFIN P.U.H. Andrzej Serafin
ul. Widokowa 1
32-088 Przybysławice
tel.: +48 12 434 41 00
fax: +48 12 398 36 69
e-mail: [email protected]
www.avantpolska.pl
AVANT – Fińskie ładowarki wielofunkcyjne. W zależności od
modelu mogą podnieść do 1500 kg na wysokość do 350
cm. Kompaktowe wymiary pozwalają na komfortową prace
w bardzo wąskich budynkach gospodarczych. Hydrostatyczny napęd na 4 koła. Mocne i ekonomiczne silniki diesla
japońskiej firmy Kubota. Możliwość stosowania wielu
narzędzi roboczych: krokodyl, chwytak do balotów, łyżki i
wiele innych.
AVANT – Finnish multifunctional loaders. Depending on the
model, the loaders can lift up to 1500 kg to a height of 3.5
m. Their compact dimensions allow for comfortable work
in very narrow utility buildings. Hydrostatic 4-wheel drive.
Powerful and economical diesel engines from Japanese
manufacturer Kubota. The possibility of using multiple work
attachments: silage forks, bale clamps, buckets and many
more.
Stoisko: D 294
21
Spis wystawców
List of exhibitors
Bagramet Sp. z o.o.
ul. Przemysłowa 2D
77-100 Bytów
tel.: +48 59 822 33 00
fax: +48 59 821 20 46
e-mail: [email protected]
www.bagramet.eu
AVITA Sławomir Rutz
ul. Leśna 40, 86-031 Osielsko
tel.: +48 52 324 15 10
fax: +48 52 324 15 26
www.avita.pl
Stoisko: B 185
AVITA zajmuje się produkcją i sprzedażą elementów wyposażenia technicznego obór w tym różnego rodzaju poideł
– również niezamarzających. Jesteśmy kluczowym dostawcą
środków służących do higieny doju. W celu zapoznania się z
pełną ofertą zapraszamy na stronę www.avita.pl, umozliwiającą dokonywanie zakupów bez wychodzenia z domu.
AVITA is involved in production and sales of technical equipment for cowsheds- for example different kinds of drinking-trough, also antyfreezing ones. We are a key supplier of milking
hygiene products. To see the complete range of our offer,
please visit www.avita.pl, where you can find our internet shop.
Stoisko: F 468
AXMANN Jerzy Chrzanowski
Brąswałd 54
11-001 Dywity
kom.: +48 603 528 525
e-mail: [email protected]
www.axmann.pl
Stoisko: E122, F469
Barbatus Sp. z o.o.
ul. Lwówecka 13/6
62-045 Pniewy
tel.: +48 61 842 52 15
mail: [email protected]
strona: www.barbatus.com.pl
Jesteśmy zespołem inżynierskim specjalizującym się w projektowaniu linii technologicznych dla różnych branż w tym dla
branży paszowej i spożywczej. Specjalizujemy się w doborze
energooszczędnych technologii rozdrabniania surowców.
Dostarczamy technologie suszenia niskotemperaturowego
zbóż, słomy, zielonek oraz pomiotu kurzego. Zajmujemy się
organizacją i optymalizacją procesów produkcyjnych. Prowadzimy inwestycje w systemie PM. Jesteśmy przedstawicielem marki Rotogrind, Multickracker i Balle accumulator.
We are the engineering team specialized in designing production lines for various industries including the feed and food
industries. We specialize in the selection of energy-efficient
technologies reduction of raw materials. We provide a low-temperature drying technologies cereal straw, green fodder
and chicken manure. We are engaged in the organization and
optimization of manufacturing processes. We invest in the
PM. We represent brands Rotogrind, Multickracker and Balle
accumulator.
Stoisko: D 418
BAG Polska Sp. z o.o.
ul. Leśna 10
64-120 Krzemieniewo
biuro: +48 61 651 01 03, 651 40 71
magazyn: +48 65 536 91 99
e-mail: [email protected]
www.bagpolska.pl
BAG Polska Sp. z o.o. wykonuje usługi zakiszania pasz w
rękawach foliowych BUDISSA BAG oraz usługi gniecenia i
zakiszania ziarna w rękawach. Sprzedaż rękawów foliowych
BUDISSA BAG, środków zakiszających, folii silosowych
i siatek do balotów. Firma prowadzi też sprzedaż m.in.
następujących maszyn: pras silosujących BUDISSA BAGGER;
gniotowników ziarna ROmiLL oraz MURSKA; rozrzutników
obornika i przyczep ANNABURGER oraz KRAMPE.
BAG Polska Sp. z o.o. offers bagging & storage systems of
several feed products. We also offer wet grain and maize corn
crimping and/or bagging. Our company distributes following
machines: BUDISSA BAGGER’s; ROmiLL crimpers; MURSKA
crimpers; ANNABURGER manure spreaders, tank trailers and
special trailers; KRAMPE trailers.
Stoisko: D 422
22
BARGAM S.p.A. - ITALIA
Via della Cooperazione, 20
40026 Imola (BO) - ITALY
e-mail: [email protected]
Przedstawiciel Bargam w Polsce
Farmtrade Pawel Kryjom
Wolska 55a
05-119 Stanisławów Drugi
tel.: +48 22 499 55 24
e-mail: [email protected]
Firma Bargam to czołowy producent opryskiwaczy rolniczych
i sadowniczych z kilkudziesięcioletnim doświadczeniem.
Bargam jest również uznanym na całym świecie producentem
i dostawcą belek do opryskiwaczy. W ofercie firmy Bargam
znajdują się opryskiwacze: samojezdne, ciągane, zawieszane,
kosiarki bijakowe.
Bargam Company is a leading manufacturer of sprayers
with decades of experience. Bargam is also recognized
worldwide as a manufacturer and supplier of booms for
B
spraying. The company Bargam sprayers offers sprayers: Self-Propelled, trailed, mounted, Flail mowers and
shredders.
Stoisko: A 267
P. W. BARTESKO
Bartłomiej Skowroński
ul. Floriańska 35
63-720 Koźmin Wlkp.
tel./fax: +48 62 721 66 56
kom.: +48 723 333 020
e-mail: [email protected]
www.bartesko.pl
Bednar FMT s.r.o.
Lohenicka 607
19017 Praga
Czechy
tel.: +48 601 061 999
fax: +42 0286 852 841
e-mail: [email protected]
www.stromexport.com
Stoisko: F 310
Produkujemy: kabiny do ciągników i maszyn rolniczych,
kombajnów, wózków widłowych, maszyn budowlanych oraz
drogowych, szyby hartowane płaskie i gięte do ciągników
i maszyn, dachy, błotniki, maski, zamki i inne akcesoria.
Jesteśmy producentem wózków elektrycznych platformowych.
Pojazdy napędzane są silnikiem bezszczotkowym. Wózki
stosowane są w przemyśle, magazynach, portach lotniczych
i morskich.
We are producing cabins for tractors, agricultural
machines, forklifts, heavy machinery and tempered flat
and bent glass, roofs, fenders, masks, locks and another
spare parts. We are the manufacturer of electrical platform
trucks. Those vehicles have got a drive unit with brushless
motor. They are used in the industries, stocks, airports and
seaports.
BELCHIM CROP PROTECTION Poland Sp. z o.o.
ul. Sienna 82
00-815 Warszawa
kom.: +48 606 647 681
e-mail: [email protected]
www.belchim.com
Firma Belchim Crop Protection Poland zajmuje się dystrybucją
środków ochrony roślin na terenie Polski. W ofercie firmy znajdują się preparaty służące do ochrony różnych gatunków roślin
uprawnych przed chorobami, szkodnikami oraz chwastami.
Belchim Crop Protection posiada wyłączność na dystrybucję
preparatów firm ISK Biosciences oraz FMC na terenie Europy.
Belchim Crop Protection Poland is a distributor of plant
protection chemicals in Poland. In the company’s offer
there are product used to protect many different crops from
diseases, pests and weeds. Belchim Crop Protection has the
exclusivity to distribute ISK Biosciences and FMC products all
over Europe.
Stoisko: D 558
Stoisko: C 69
„BARTNIK” Techniczne Wyposażenie Rolnictwa
ul. Mostowa 4
09-440 Staroźreby
tel./fax: +48 24 261 70 22
e-mail: [email protected]
www.bartniktwr.pl
Stoisko: C 60
Bauer Group Polska Sp. z o.o.
Jasionka 102
21-200 Parczew
tel.: +48 83 355 17 44
fax: +48 83 355 17 45
e-mail: [email protected]
www.bauerpolska.pl
Stoisko: C 201
BayWa AG
Arabella Str. 4
81925 München
Niemcy
tel.: +49 899 22 20
e-mail: [email protected]
www.baywa.de
Stoisko: C 199
Ford Bemo Motors
ul. Mogileńska 50
61-044 Poznań
tel.: +48 61 874 77 71
fax: +48 61 874 77 27
e-mail: [email protected]
www.bemo-motors.pl
Bemo Motors, to autoryzowany dealer marki Ford działający w
Poznaniu, Szczecinie, Koszalinie i Warszawie. Oferujemy kompleksową obsługę klientów indywidualnych i instytucjonalnych.
W strukturze firmy funkcjonuje dział dedykowany samochodom dostawczym - Centrum Pojazdów Dostawczych. Oferuje
on samochody dostawcze oraz samochody z zabudową
specjalistyczną, dostosowaną do potrzeb finalnego odbiorcy.
Bemo Motors, the authorized dealer of Ford brand, running in
Poznan, Szczecin, Koszalin and Warsaw. We offer comprehensive services for individual and corporate clients. Through
the company structure there is a special department dedicated
for vans - Commercial Vehicle Centre. It offers vans and cars
with special building, customized to the needs of the final
consumer.
Stoisko: E 297
23
Spis wystawców
List of exhibitors
The company is a Polish producer of plant protection agents
and agents used for the sanitary hygiene. Our offer includes,
amongst the others, agents for protection of rape against weeds and diseases, for fighting the Colorado beetle, aphids, field
and pest rodents and flies in dwelling and livestock facilities.
BERLING S.A.
Al. Krakowska 80a
05-552 Stefanowo
tel.: +48 22 727 84 97
fax: +48 22 736 28 99
e-mail: [email protected]
www.berling.pl
Stoisko: A 319
BERLING SA - największa hurtownia urządzeń chłodniczych w
Polsce, specjalizująca się w przechowalnictwie owocowo-warzywnym. Wyłączny dostawca chłodnic Goedhart; największy
dystrybutor sprężarek Bitzer; wyłączny dostawca agregatów
firmy Arkton; profesjonalne doradztwo, dobory i kompletacja;
montaż i serwis na terenie całego Kraju realizowany przez sieć
współpracujących firm serwisowych.
BERLING SA - the largest refrigeration wholesaler in Poland,
specialized in fruit and vegetable storage. Sole supplier of
Goedhart air coolers; biggest distributor of Bitzer compressors;
exclusive supplier of Arkton refrigeration units; professional
counseling, and product selection; service and installation
carried out by service network in whole Country.
Stoisko: hala 20
Bezalin S.A.
ul. Piastowska 43
43-300 Bielsko-Biała
tel.: +48 33 812 30 81
fax: +48 33 816 96 94
e-mail: [email protected]
www.bezalin.com.pl
BEZALIN S. A. lider na krajowym rynku technicznych wyrobów
włókienniczych. Producent: sznurka rolniczego, siatki do
belownic, wyrobów powroźniczych kręconych i plecionych z
surowców naturalnych oraz sztucznych, węży pożarniczych,
budowlanych i gospodarczych.
BEZALIN S.A. – a leader in the domestic market of technical
textiles. Producer of baler twine, net wrap, twisted and braided
ropes – natural and synthetic; fire hoses, industrial and
building hoses.
Stoisko: hala 25
BERUTEX Sp. z o.o.
ul. Opolska 30
55-011 Siechnice
tel.: +48 71 311 38 88
fax: +48 71 311 58 06
Oferujemy Państwu: Consentisoferta Biogazowni do zakresu
MW. MÖLLER – fotowoltaika; BVL – paszowozy od 6 do 40
m³; BRIRI - rozrzutniki obornika ( wapno, obornik, pomiot),
przyczepy objętościowe; ZUNHAMMER - wozy asenizacyjne do
27m3, oprzyrządowanie; BRAND - mieszadła – kanałowe do
zbiorników otwartych, zamkniętych, lagun, zbiorniki naziemne
do 8 m wysokości; VOGELSANG - samozasysające pompy do
gnojowicy; LEHNER – wysiewacz do traw i poplonów.
Stoisko: E 228
Zakład Produkcyjno Usługowo Handlowy
BEST – PEST M. J. Świętosławscy sp. j.
ul. Moździerzowców 6 b
43-602 Jaworzno
tel.: +48 32 617 75 71, 617 75 62, 617 74 34
e-mail: [email protected]
www.bestpest.com.pl
Firma jest polskim producentem środków ochrony roślin i
preparatów stosowanych w higienie sanitarnej. W ofercie są
między innymi środki do ochrony rzepaku przed chwastami
i chorobami, do zwalczania stonki ziemniaczanej, mszyc,
gryzoni polnych i sanitarnych oraz much w mieszkaniach i
budynkach inwentarskich.
24
BG Poland Sp. z o.o.
ul. Transportowa 1
62-020 Swarzędz-Garby
tel.: +48 61 855 01 85
e-mail: [email protected]
www.bgpoland.pl
BG Poland Sp. z o.o. jest dystrybutorem produktów BG
Products Inc. na terenie Polski.Przez 42 lata firma BG stawia za
swój cel dostarczenie wszystkim klientom długotrwałych rozwiązań bezawaryjnej pracy pojazdów. Produkujemy preparaty
oraz urządzenia używane przez serwisy, floty, przedsiębiorstwa
komunalne oraz rolne. Stosowanie technologii BG pomoże podnieść skuteczność oferowanych usług i zwiększy zyski firmy.
BG Poland Sp. z o.o. is a distributor of BG Products Inc. for
Poland. BG company for 42 years is committed to providing
prolonged trouble-free automotive performance for every BG
customer. We manufacture our own products and tools for application by automotive services, fleets, municipal and agricultural companies. We expand the profit-potential of companies,
while ensuring automotive maintenance of superb reliability.
Stoisko: F 162
B
BIN Sp. z o.o.
ul. Narutowicza 12
87-700 Aleksandrów Kujawski
tel.: +48 54 282 88 00
fax: +48 54 282 88 63
e-mail: [email protected]
www.bin.agro.pl
BIALPAK Spółka Jawna
ul. Leszczynowa 1 H
21-500 Biała Podlaska
tel.: +48 83 342 23 80
fax: +48 83 344 12 04
e-mail: [email protected]
www.bialpak.pl
Stoisko: C 394
Firma Bialpak istnieje od 1994 roku. Posiadamy największą
ofertę folii kiszonkarskich znanych, cenionych europejskich
producentów. Od 15 lat jesteśmy dystrybutorem folii do
sianokiszonek Silotite. Importujemy również wielosezonowe
siatki ochronne, folie podkładowe, taśmy naprawcze z filtrem
UV, siatkę do pras (Netzwerk, Juta) i sznurek.
Bialpak Company was founded in 1994. We have the largest
offer of well-known haylage film, reputable by European manufacturers. Since 15 years we distribute films for haylage Silotite.
We import the multigrade gratings, groundwork film, tape repair
with UV filter, mesh feeders (Netzwerk, Jute) and cord.
Stoisko: C 531
Binotto Polska Sp. z o.o.
Cieśle 14 J
56-400 Oleśnica
tel.: +48 71 399 17 55
fax: +48 71 399 17 47
www.binotto.com
BINOTTO-MARIZ produkcja: siłowników hydraulicznych do wywrotek rolniczych i sprzętu rolniczego oraz pomp próżniowych
do rozlewaczy nawozów płynnych i beczek asenizacyjnych.
BINOTTO-MARIZ production: hydraulic cylinders for agri - tipper
trailers and agri equipment and machines, vacuum pumps for
sultry tanks trailers.
Stoisko: F 138
Big Dutchman Polska Sp. z o.o.
ul. Sowia 7
62-080 Tarnowo Podgórne
tel.: +48 61 896 28 00
fax: +48 61 816 44 51
e-mail: [email protected]
www.bigdutchman.pl
Big Dutchman jest światowym liderem na rynku wyposażenia
do nowoczesnego chowu drobiu i hodowli trzody chlewnej.
Zakres wyposażenia obejmuje systemy zadawania paszy,
systemy pojenia, systemy sterowania klimatem w budynkach
inwentarskich, klatkowe i ściółkowe systemy utrzymania drobiu oraz systemy zbioru jaj. Oferujemy również kompleksowe
projektowanie i budowę biogazowni oraz wytwórnie pasz.
Big Dutchman is the recognized market leader in feeding
systems and housing equipment for modern pig and poultry
management. In our offer you can find feeding and drinking
systems, environment control systems, floor and free-range
management systems as well as egg collection systems. We
provide also biogas plants and feed mills.
Stoisko: E 434
Big Green Egg
ul. Jutrzenki 12
02-233 Warszawa
tel.: +48 22 575 39 99
fax: +48 22 575 39 98
e-mail: [email protected]
www.biggreenegg.com.pl
Biogaz-Tech Sp.z.o.o.
ul. Jana III Sobieskiego 7
40-082 Katowice
tel.: +48 32 2530521
e-mail: [email protected]
Biogaz-Tech Sp. z o.o. swoją działalność rozpoczęła w 2008
roku jako dostawca technologii firmy Biogas weser-ems GmbH
& Co, która posiada 13 letnie doświadczenie oraz ponad 300
zrealizowanych biogazowni. Swoje usługi świadczymy na
terenie całego kraju, począwszy od planów kończąc na budowie. Możemy się poszczycić wieloma uzyskanymi decyzjami
środowiskowymi, projektami oraz realizacjami. Biogazownie
rolnicze to nasza specjalność.
The activity of Biogaz-Tech Sp. z o.o. started in 2008 as a supplier of Biogas wesser-ems GmbH & Co technology, which has
13 years of experience and over 300 biogas plants completed.
We provide service in the whole country – from projects to
building. We can take pride in many positive environmental approvements, completed projects and participation in realisation
of the ventures. Agricultural biogas plants are our speciality.
Stoisko: F 461
Stoisko: E 598
25
Spis wystawców
List of exhibitors
Biuro Doradczo-Handlowe JACEK KRÓL
ul. Igielna 6/3
50-117 Wrocław
tel.: +48 71 315 62 13
fax: +48 71 314 63 01
e-mail: [email protected]
www.opryskiwacze.com
BIOPROJECT
GREEN ENERGY
BIOPROJECT s.r.o.
Výstavní 135/107
703 00 Ostrava – Vítkovice
Czechy
tel.: +420 595 953 013
fax: +420 595 952 254
e-mail: [email protected]
www.bioproject.cz
Stoisko: E 236
Spółka BIOPROJECT to czołowa firma czeska zajmująca się
projektowaniem, budową oraz eksploatacją biogazowni, która
oferuje swym klientom bezkonkurencyjny pakiet usług oraz
pierwszorzędne zaplecze techniczne i rozwojowe. Zapewniamy
kompleksowe dostawy biogazowni pod klucz, ich eksploatację
oraz serwis. Pomagamy z wykorzystaniem roślin uprawnych
lub odpadu do produkcji energii elektrycznej oraz ciepła.
BIOPROJECT is a leading Czech company in the area of design,
construction and operation of biogas power plants offering
its customers an unrivalled range of services, and first-class
technical and development backgrounds. We assure complete
turnkey deliveries of biogas power plants, their operation and
service. We contribute to utilisation of agriculture products for
the production of electric energy and heat.
Blattin Polska Sp. z o.o.
Siedlec, ul. Poznowicka 1
47-180 Izbicko
e-mail: [email protected]
www.blattin.pl
W naszej ofercie znajdują się mieszanki paszowe uzupełniające, koncentraty oraz pasze pełnoporcjowe dla zwierzą, produkty higieny doju, folie kiszonkarskie, siatki do owijarek, materiał
siewny i dodatki do zakiszania. Nowością w ofercie są usługi
ryflowania posadzek w oborach, mycia hal udojowych oraz
sprzedaż wozów paszowych. Hodowcy, którzy zaufali Blattin
otrzymują kompleksową usługę doradztwa żywieniowego oraz
usługi laboratoryjne w technice NIRS.
Stoisko: B 351
Stoisko: hala 40
BIO-WORLD Sp. z o.o.
Bratuszyn 21
62-720 Brudzew
tel.: +48 63 220 44 85
e-mail: [email protected]
www.bio-world.pl
Stoisko: A 326
BITZER TECHNIKA WAŻENIA
ul. Rakowicza 31
60-475 Poznań
tel.: +48 664 786 986
e-mail: [email protected]
www.bitzer-wagi.pl
Bitzer Technika Ważenia jest dostawcą kompletnych systemów
ważenia. Oprogramowanie BITZER AGRAR pozwala na
rozszerzenie możliwości ważenia. Urządzenie do badania prób
BITZER w laboratorium o przyspiesza procesy sprawdzania
jakości, dzięki analizie wszystkich ważnych wartości zboża i
przekazywaniu do banku danych systemu BITZER AGRAR.
Bitzer Wiegetechnik is a supplier of complete weighing
systems. The company possesses exceptional expertise in
agribusiness. The software BITZER AGRAR brings together
weighing data from various scale types as well as quality
values from the grain laboratory at the same database in order
to fulfill the legal necessities of traceability.
Stoisko: hala 27
26
BLYSS Polska Sp. z o.o.
Lasowice Wielkie 42 A
46-280 Lasowice Wielkie
tel.: +48 77 416 21 21
fax: +48 77 416 21 23
e-mail: [email protected]
www.przyczepy-samochodowe.com
Firma Blyss Polska Sp. z o.o. jest producentem oraz sprzedawcą wysokiej jakości przyczep i lawet o różnorodnych
wymiarach i pełnym zakresie mas( od 750 kg do 3500 kg), co
pozwala stworzyć przyczepę idealnie dopasowaną do każdego
rodzaju pojazdu. W ofercie można również znaleźć zabudowy
pojazdów dostawczych i ciężarowych oraz przyczepy: gastronomiczne, do przewozu maszyn budowlanych, do transportu
zwierząt, łodzi, kajaków, agregatów.
Blyss Polska Sp. z o.o. is a producer and retailer of high-quality trailers and carriages of various dimensions and full
range of weights (from 750 kg to 3500 kg) which allow us to
create a trailer perfectly suited to every type of vehicle. The
offer also includes bodies for delivery and goods vehicles as
well as trailers: gastronomy trailers, trailers for transporting
construction equipment, trailers for transporting animals,
boats, kayaks and units.
Stoisko: C 74
B
stosujemy do rozkładu masy organicznej (słomy) i odbudowy
próchnicy w glebie. Wzrost zawartości próchnicy powoduje poprawę struktury gleby i udostępnienie składników.
Umożliwia to łatwiejszą uprawę gleby,lepsze odżywienie roślin i
wzrostu plonów, co podnosi opłacalność produkcji rolnej.
Stoisko: B 337
BM Kobylin Sp. z o.o.
ul. 1 maja 3
63-760 Zduny
tel./fax: +48 62 725 22 45
kom.: +48 603 506 507
e-mail: [email protected]
www.bmkobylin.pl
Stoisko: B 335
Zakłady Mięsne BM Kobylin
ul. 3 maja 3
63-740 Kobylin
tel.: +48 65 548 10 58
fax: +48 65 548 10 58
e-mail: [email protected]
www.zmbmkobylin.pl
Bohnenkamp AG
Dieselstr. 9-13
49076 Osnabrück
Niemcy
tel.: +49 (0) 541 12163-0
fax: tel.: +49 (0) 541 12163-944
e-mail: bohnenkamp.de
www.bohnenkamp.de
Stoisko: E 227
Stoisko: F 474
BNP Paribas Leasing Solutions
ul. Suwak 3
02-676 Warszawa
tel.: +48 22 566 96 88
fax: +48 22 566 96 59
e-mail: [email protected]
BNP Paribas Leasing Solutions jest częścią globalnej, wiodącej
na rynku europejskim, grupy kapitałowej BNP Paribas. W
Polsce już od kilkunastu lat służymy Państwu swoim doświadczeniem, oferując usługi finansowe na najwyższym poziomie.
Jesteśmy liderem finansowania maszyn rolniczych. Pozycja ta
została osiągnięta dzięki programom współpracy z producentami najlepszych maszyn dostępnych na rynku.
BNP Paribas Leasing Solutions is a part of a global leader on
the European market, the BNP Paribas Group. We are present
in Poland from over a dozen years. We provide our Clients with
financial services at the highest level. BNP Paribas Leasing
Solutions is a leader in agricultural sector on the Polish leasing
market. This position was achieved through vendor programs
with the best producers of agri equipment.
P.P.H.U. "Bomet" Andrzej Sińczuk
ul. Berka Joselewicza 2
07-100 Węgrów
tel.: +48 25 792 38 88, 25 691 78 06
fax: +48 25 792 27 32
e-mail: [email protected]
www.bomet.pl
P.P.H.U. BOMET produkuje: agregaty uprawowe, agregaty
uprawowo-siewne, agregaty podorywkowe, wały strunowe,
kultywatory, kopaczki, brony talerzowe, brony talerzowe
kompaktowe, brony wirnikowe, pługi, sadzarki do ziemniaków,
pielniko-obsypniki, glebogryzarki, głębosze, siewniki zbożowe.
P.P.H.U. BOMET produce the following: tillage outfits, tilling and
sowing set, skimming unit, string rollers, cultivators, digger,
disc harrows, rotor harrow, ploughs, potato planters, hoe
ridgers, rototillers, subsoilers, seeders.
Stoisko: F 301
BONDIOLI-PAVESI Sp. z o.o.
ul. Poznańska 71
76-200 Słupsk
tel./fax: +48 59 842 72 69
e-mail: [email protected]
www.bondiolipavesi.pl
Stoisko: C 61
Stoisko: B 20
P.P.H.U. BOGDAN
Bolesławowo 40/1
83-250 Skarszewy
tel.: +48 58 586 00 72 73
tel./fax: +48 58 588 22 42
e-mail: [email protected]
www.bogdan.agro.pl
BORGA Sp. z o.o.
Siedziba główna:
ul. Rdestowa 43
81-577 Gdynia
Zakład produkcyjny:
99-122 Góra Św. Małgorzaty 92
tel.: +48 58 62 99 444
fax: +48 58 62 99 303
e-mail: [email protected] (hale stalowe)
[email protected] (dachy, komponenty dachowe)
www.borga.pl
Firma BOGDAN zajmuje się wprowadzaniem na rynek środka
podnoszącego urodzajność gleby o nazwie UGmax. UGmax
Firma Borga projektuje, produkuje, sprzedaje i montuje własny
system prefabrykowanych hal stalowych. Sprzedajemy także
27
Spis wystawców
List of exhibitors
wszelkie komponenty wykorzystywane w procesie budowy hal
oraz dachów w domach jednorodzinnych. Jesteśmy obecni w
11 krajach Europy. Produkcja odbywa się we własnych zakładach produkcyjnych w Szwecji, Polsce, Rumunii i na Litwie.
tel.: +48 42 717 78 68
fax: +48 42 717 45 85
e-mail: [email protected]
www.brokerserwis.com.pl
Stoisko: A 14
Borga design, produce, market and assemble its own system
of steel buildings. We also sell components used in building
process and in private houses’ roofs. Now we are established
in 11 European countries. Manufacturing takes place in Sweden, Poland, Lithuania and Romania.
Stoisko: hala 23
Brown & Co Sp. z o.o.
ul. Bydgoska 1
87-100 Toruń
tel.: +48 56 621 10 62
fax: +48 56 621 10 61
e-mail: [email protected]
www.brown-co.pl
BRANDI
Złotki 45
07-140 Sadowne
tel.: +48 516 257 886
Stoisko: C 495
Firma ''BRANDI'' została założona w 1993 roku. Zajmujemy się
produkcja i sprzedażą maszyn rolniczych. Produkujemy m.in.
opryskiwacze polowe i sadownicze, zawieszane i zaczepiane,
rozsiewacze nawozów. Zapraszamy do zapoznania się z naszą
ofertą!
Stoisko: C 58
BRAT-MET Janik Spółka Jawna
ul. Słowackiego 346
26-600 Radom
tel.: +48 48 360 54 54
fax: +48 48 360 54 55
e-mail: [email protected]
www.brat-met.com.pl
Zakład Budowy Kotłów „BUD-KOT” Mirosław Śliwa
ul. Polna 6
63-300 Pleszew
tel.: +48 62 508 31 61; 62 508 31 53
fax: +48 62 742 90 30
e-mail: [email protected]
www.budkot.pl
Zakład Budowy Kotłów „BUD-KOT” z siedzibą w Pleszewie
działa już od 25 lat. Jesteśmy producentem kotłów grzewczych
z automatycznym podawaniem paliwa i z zasypem ręcznym oraz
innych urządzeń związanych z ciepłownictwem takich jak: kotły –
wytwornice pary, wymienniki ciepła, nagrzewnice powietrza itp..
Stoisko: D 98
Based in Pleszew - "BUD-KOT" company has been running for
25 years. We are a manufacturer of boilers with automatic/
manual fuel feeder and other heating devices and accessories,
such as steam generators, heat exchangers, air heaters etc.
Stoisko: D 561
PH BRATPOL Jerzy Bratkowski
ul. Jana z Kolna 24/26
81-351 Gdynia
tel.: +48 58 661 65 01
fax: +48 58 661 64 62
e-mail: [email protected], [email protected]
www.bratpol.pl
Firma istnieje od 1983 roku. W swojej ofercie posiadamy worki
Big-Bag, worki polipropylenowe, plandeki okryciowe, worki
raszlowe, siatki do owijania palet, agrotkaniny, agrowłókniny,
worki papierowe, worki przeciwpowodziowe, sznurek rolniczy,
torby ekologiczne.
Our company exist on Polish market since 1983. We can
offer following products: Big-Bags, Small polypropylene bags,
Tarpaulins, leno/mesh bags, nets for pallet wrapping, paper
bags, flood defense bags, PP Twine, eco bags and many other
products which You may find on our web site.
Stoisko: C 510
BROKER SERWIS
Maszyny Budowlane
Przedsiębiorstwo Handlowo-Usługowe
Jan Surma
ul. Okólna 64
95-002 Łagiewniki Nowe
28
Bühler Polska Sp. z o.o.
Biuro Wrocław
ul. Strzegomska 204A/6
54-432 Wrocław
tel.: +48 71 349 25 02
e-mail: [email protected]
www.buhlergroup.com
www.schmidt-seeger.com
Bühler – Grain Logistics jest globalnym dostawcą profesjonalnych
technologii w zakresie urządzeń transportujących, maszyn czyszczących, innowacyjnych suszarni oraz magazynów zbożowych.
Obecnie dostarczamy urządzenia i kompletne rozwiązania do
punktów skupu zboża, terminali portowych, słodowni, mieszalni
pasz, zakładów produkujących żywność, czyli – dla całego łańcucha żywnościowego związanego z sektorem zbożowym.
Bühler – Grain Logistics is a global supplier of professional technologies in the field of conveying equipment, cleaning machines,
innovative dryers and grain storages. At present we provide the
equipment and solutions for grain collection points, port terminals, malting plants, fodder mixing plants and food manufacturers
– i.e. for the whole food chain connected with grain segment.
Stoisko: C 401
B
ul. Św. Ducha 120
63-200 Jarocin
tel./fax: +48 62 505 00 01
Rafał Iwan
Przedstawiciel handlowy
kom.: + 48 692 204 661
e-mail: [email protected]
Waldemar Plottnik
tel.: + 49 2545 919 313
tel.: + 49 16 095 979 711
e-mail: [email protected]
Bulmach Sp. z o.o.
02-761 Warszawa
ul. Cypryjska 20
tel.: +48 22 840 65 68
fax: +48 22 112 12 23
e-mail: [email protected]
www.bulmach.pl
Podzespoły hydrauliki siłowej: pompy zębate pojedyncze i
wielostrumieniowe, zamienniki pomp BOSCH, inne; pompy
wielotłoczkowe; silniki gerotorowe, zamienniki DANFOSS,
i in.; orbitrole, zamienniki DANFOSS; rozdzielacze ręczne;
rozdzielacze elektromagnetyczne; panele – pulpity sterujące
do elektrozaworów sterujących hydraulika siłową (12V, 24V);
miniagregaty hydrauliczne; zawory hydrauliczne
Hydraulic components: gear pumps up to 4 sections; analog
for BOSCH, CASAPPA, PARKER other.; piston pumps; hydraulic motors, analog for DANFOSS, and other; hydraulic steering
units, analog for DANFOSS; hydraulic directional control
valves, manually operated, monoblock & sectional; directional
control valves with solenoid; panels for solenoid valves (12V,
24V); powerpacks, minipowerpacks; valves.
Firma Buschhoff jest producentem i dostawcą nowych i
używanych mobilnych instalacji mielących, gniotących i mieszających typu TOURMIX i AFM oraz nowych stacjonarnych
instalacji mielących i mieszających. Oferta wyrobów: Technologie dla ziarna, od przechowywania, poprzez przetwarzanie
do karmienia.
Buschhoff is manufacturer and supplier of brand-new and used
mobile Grinding, Rolling and Mixing Plants Type TOURMIX and
AFM and brand-new stationary Milling and Mixing Plants. Product range: Technology for grain from storaging, processing
to feeding.
Stoisko: C 404
Stoisko: F 137
Buttimer Polska Sp. z o. o.
ul. Cypryjska 2a
02-761 Warszawa
tel.: +48 22 858 20 03
fax: +48 22 858 20 05
e-mail: [email protected]
www.buttimer.pl
BURY Maszyny Rolnicze- Wojciech Bury
Woźniaków 4B
99-300 Kutno
tel.: +48 24 254 20 48
tel./fax: +48 24 253 36 32
e-mail: [email protected]
www.bury.com.pl
BURY Maszyny Rolnicze to Firma zajmująca się produkcją
opryskiwaczy polowych i sadowniczych (o pojemności od 400
do 6000 litrów - zawieszanych, zaczepianych i samojezdnych) oraz tradycyjnych i kompaktowych bron talerzowych o
szerokości roboczej od 1,70 do 8 metrów. Maszyny firmy Bury
charakteryzują się nowoczesnymi rozwiązaniami.
Bury is the manufacturer of field and orchard sprayers ( mounted, trailed and self propelled: 400L- 6000), compact disc
harrow and disc harrow (mounted, trailed: 1,7m -8,0m). The
machines of Bury are know as modern solusion for agriculture.
Stoisko: F 301
BUSCHHOFF, Th. Gmbh & Co.
Kruppstrasse 44
D-59227 Ahlen
tel.: + 49 23 82 80 840
fax: + 49 23 82 80 84 21
e-mail: [email protected]
www.buschhoff.de
Przedstawicielstwo w Polsce:
Plottnik AgroConsulting
Buttimer Polska od wielu lat specjalizuje się w projektowaniu, doradztwie i wykonawstwie obiektów w obrębie takich
sektorów przemysłu jak masowy transport towarów sypkich,
nasiennictwo, magazynowanie czy wytwórnia pasz. Buttimer
stara się wyjść naprzeciw oczekiwaniom Klientów i oferować
im projekty oraz rozwiązania przystosowane do ich potrzeb
oraz warunków terenowych. Nasza oferta obejmuje urzadzenia
oraz kompletne linie dla nasiennictwa.Buttimer dysponuje
własnymi, kompletnymi rozwiązaniami i dostarcza urządzenia
dla m.in. sektora magazynowania czy masowego transportu
towarów sypkich.
Buttimer Poland has been specializing for many years in
designing, consulting and construction of facilities within
industry sectors, such as, dry bulk handling, seed processing,
storage or feed milling. Buttimer has striven come up to its
client's expectations, and to offer them designs, complete and
custom-made solutions specifically suited to their needs and
local conditions. Buttimer offers its own complete projects and
solutions and supplies the market with equipment for, among
the others, storage or bulk handling sectors.
Stoisko: C 387
29
Spis wystawców
List of exhibitors
Carré SAS
St Martim des Moyers
85140 ZA Les Fours
tel.: +33 25 107 82 35
fax: +33 251 07 80 75
email: [email protected]
www.carre.fr
Beco Polska
ul. Walczaka 110
66-400 Gorzów Wielkopolski
tel.: +48 535 537 590
e-mail: [email protected]
www.beco-vianen.com
Przyczepy BECO są niezwykle cenionymi przyczepami.
Produkty BECO znane są ze swojej trwałości, solidnej konstrukcji i przemyślanego projektu. Gama produktów Beco:
Wywrotki rolnicze 2 i 3 osiowe od 10 do 28 ton, Wywrotki
do przewozu materiałów płynnych, Przyczepy hakowe
do 30 ton, Przyczepy budowlane do 80 ton, Osprzęt do
koparek i ładowarek, W oparciu o nasze doświadczenie nie
boimy się więc stwierdzić: „BECO SPROWADZI PAŃSTWA
PLON DO DOMU”
Beco trailers. BECO products are known for their durability,
solid construction and meticulous design. To sum it up, the
quality is in the details. The Beco range: Agricultural tipping
trailers, 2 and 3 axles from 10 to 28 tons loading capacity,
Slurry tippers, Hook lift trailers with loading capacity up to
30 tons, 2, 3, 4 axle construction tippers with loading capacity up to 80 tons, Excavators and wheel loaders equipment,
“BECO BRINGS IN YOUR HARVEST”
Stoisko: E 130
BZK Group Sp. z o.o.
Świętokrzyska 6
96-515 Tersin
tel./fax: +48 77 416 31 37
e-mail: [email protected]
www.bzkgroup.pl
Stoisko: E 580
CAMARA POLONIA
JESUS MANUEL CAMARA PEREZ
Wojska Polskiego 75
98-200 Sieradz
tel.: +48 43 822 78 32
fax: +48 43 822 78 32
e-mail: [email protected]
CARRE concepts and makes a complete range of agricultural
machineries, distributed in 5 products lines, specialized in soil
preparation,(subsoiler, danish cultivator) sowing and fertilizing,
(tine seed drill, localised fertilizer) as well as crops maintenance
(hoeing machine, weeding harrow, rotary hoe etc…). Its range of
products is known to be solid, attractive constructions, easy to
maintain, use and adjust.
Stoisko: E 298
CASE IH Polska
ul. Otolińska 25
09-407 Płock
tel.: +48 24 267 96 75
e-mail: [email protected]
www.caseih.com
Dzięki doświadczeniu i wkładowi w historię maszyn rolniczych
produkty firmy Case IH od ponad 160 lat wybierane są przez
profesjonalnych rolników z całego świata. Szeroka gama ciągników, kombajnów oraz pras zapewnia efektywność, wydajność
i niezawodność. Klienci marki Case IH otrzymują fachowe
wsparcie, a także innowacyjne rozwiązania oferowane przez sieć
profesjonalnych dealerów.
Case IH is the professionals' choice, drawing on more than 160
years of heritage and experience in the agricultural industry. A
powerful range of tractors, combines and balers deliver productivity, efficiency and reliability. Case IH clients are provided with
the superior support and innovative solutions offered by a global
network of highly professional dealers.
Stoisko: D 284
Stoisko: E 230
Cargill Poland Sp. z o.o.
ul. Rolna 2/4
62-280 Kiszkowo
tel.: +48 61 424 91 00
fax: +48 61 424 91 01
e-mail: [email protected]
www.lnb.pl
Celli spa
Masetti 32
47122 Forli
Włochy
tel.: +39 0543 794711
fax: +39 0543 794747
e-mail: [email protected]
www.celli.it
Stoisko: B 28
Stoisko: B 347
CEMBRIT Sp. z o.o.
ul. Puławska 405A
02-801 Warszawa
tel.: +48 22 544 09 25
fax: +48 22 544 09 28
30
C
Dział sprzedaży:
tel.: +48 61 415 43 30
fax: +48 61 415 60 17,
e-mail: [email protected]
www.cembrit.pl
System Dachowy EuroFala – ekologiczny i ekonomiczny system
pokryć dachowych przeznaczony do krycia budynków inwentarskich i gospodarczych. Płyta EuroFala dostępna jest w 9 kolorach
standardowych i naturalnym szarym oraz w 4 długościach 625,
1250, 1875, 2500mm i szerokości 1150mm. W ofercie znajdują
się również akcesoria wykończeniowe oraz akcesoria montażowe
nadające dachom estetycznie wyglądające wykończenie.
EuroFala Roofing System is an economical and environment-friendly roofing material used to cover agriculture buildings.
EuroFala is available in ten colours (including natural grey) and
four lenghts 625mm, 1250mm, 1875mm, 2500mm and width
1150mm. In our offer you can also find roofing accessories such
as bargeboards and ridges as well as fixing accessories which
give a roof a professional finish.
Stoisko: D 420
przemysłowych oraz samochodów osobowy i dostawczych.
Firma istnieje na rynku od ponad 30 lat i proponuje swoim
klientom między innymi: panewki, uszczelki, tłoki tuleje, pierścienie tłokowe, głowice i części do głowic, wały korbowe, wałki
rozrządu i wiele innych. Oferta zawiera części do maszyn: Zetor,
Ursus, Deutz, Fendt/MWM, Massey Ferguson, Case-IH, Leyland,
Perkins, Same i do innych. Dewizą firmy jest wysoka jakość produktów, dostępność części oraz wyszkolona kadra pracowników
która szybko i bezbłędni realizuje zamówienia. Sprzedaż odbywa
się za pośrednictwem 25 oddziałów zlokalizowanych na terenie
całej Polski.
Cer-Motor Company - direct importer of engine spare parts
for agricultural and construction machines, forklifts, stationary
engines, for passenger cars and light trucks. Our company
was established in 1980. We have the following assortment of
parts: engine bearings, engine gaskets, pistons, cylinder liners,
piston rings, cylinder heads, cylinder head parts, crankshafts,
camshafts and many others. The offer include parts for: Zetor,
Ursus, Deutz, Fendt/MWM, Massey Ferguson, Case-IH, Leyland,
Perkins, Same and many others. Our staff is high qualified
experts on engines. In our offer you can find high quality parts at
the wide price range and availability. We sell our products by 25
of our branches in Poland.
Stoisko: F 159
Center Plast Sp. z o.o.
ul. Strzeleckiego 6
47-133 Jemielnica
tel.: +48 77 404 85 55
fax: +48 77 404 85 57
email: [email protected]
www.centerplast.pl
Importer folii rolniczych, ogrodniczych, budowlanych, nasze
marki firmowe to: SILO-VIT, HELLASNET, QUATRO, GARDEN-VIT,
WILUNEX.
Stoisko: B362, C508
CFCAI SAS
Route de Montgerain – B.P. 04
60420 Tricot - Francja
tel.: +33 (0)3 44 51 53 50
fax: +33 (0)3 44 51 00 84
e-mail: [email protected]
www.cfcai.com
Dyrektor Handlowyt: Didier THENAULT
tel.: +33 (0)3 44 51 53 53
CENTRUM TECHNIKI ROLNICZEJ Sp. z o.o.
ul. Szarych Szeregów 14
63-000 Środa Wielkopolska
tel.: +48 61 285 38 28
fax: +48 61 285 24 49
e-mail: [email protected]
www.goldoni.pl
Stoisko: C 507
Specjalista « techniki po zbiorach », z markami: LAW dla
suszarń, DAGUET dla przenośników i MAROT dla czyszczenia i
sortowania ziarna. Nasze biura projektowe opracowują instalacje
"pod klucz": Suszenie – Czyszczenie – Magazynowanie –
Transport.
Cer Motor Sp. z o.o.
Dziewosłęby 22
04-403 Warszawa
tel.: +48 22 612 88 77
fax: +48 22 673 45 55
e-mail [email protected]
www.cermotor.com.pl
Le spécialiste de l’après récolte, avec nos marques: LAW
pour les séchoirs, DAGUET pour la manutention et MAROT
pour le nettoyage, calibrage des grains. Nos bureaux d’études
conçoivent des installations clés en main: Séchage – Nettoyage –
Stockage – Manutention.
The specialist of the Post-harvest, with our trademarks: LAW
for the dryers, DAGUET for the handling and MAROT for the
cleaners, graders and processing of any kind of grain and seeds.
Our design department conceive turnkey project: Drying – Cleaning – Storage – Handling.
Stoisko: E 298
Cer Motor –importer części silnikowych do maszyn rolniczych,
budowlanych, wózków widłowych, ciężarowych, silników
31
Spis wystawców
List of exhibitors
CHAPMANS
Club Mill Road, Sheffield
S6 2FH England
tel.: +44 (0)114 285 6000
fax: +44 (0)114 285 6001
e-mail: [email protected]
www.chapmans-uk.com
CMKS Polska Spółka z o.o.
Stara Wieś, ul. Jemiołowa 70
05-830 Nadarzyn
tel.: +48 22 739 94 71
fax: +48 22 739 94 72
e-mail: [email protected]
www.lspolska.com
Producent trudno ścieralnych części zamiennych do maszyn
rolniczych obejmujących asortyment części pancerowanych/
napawanych Arma.
Manufacturer of wear resistant parts for agricultural machines
and the Arma range of hard surface coatings.
Stoisko: B 35
CLAAS Polska Sp. z o.o.
Niepruszewo, ul. Świerkowa 7
64-320 Buk
kom.: +48 661 461 461
www.claas.pl
The general distributor in Polish market: LS brand municipal,
orchard and farm tractors, spare parts. CMKS Polska Sp. z o.o.
provides a wide range of implements for municipal sector and
professional service and maintenance.
Stoisko: C 210
CLAAS jest niemiecką firmą rodzinną oraz wiodącym światowym
producentem maszyn rolniczych, który zatrudnia ponad 9000
pracowników przy rocznych obrotach przekraczających trzy miliardy euro. 14 zakładów produkcyjnych na całym świecie, liczne
spółki zależne, w tym także CLAAS Polska Sp. z o.o. oraz gęsta
sieć handlowa i serwisowa, gwarantują wszystkim klientom
bliski i bezpośredni kontakt z firmą. Kombajny zbożowe CLAAS
zdobyły wiodącą pozycję na rynku europejskim, a sieczkarnie
polowe CLAAS zajmują pierwsze miejsce w skali światowej.
Paleta produktów obejmuje także ciągniki, prasy kostkujące
i rolujące, maszyny do zbioru użytków zielonych, ładowacze
teleskopowe i najnowszą technologię informacyjną w dziedzinie
rolnictwa. Zapraszamy do zapoznania się z nowościami CLAAS
na rok 2011! CLAAS - Jesteśmy blisko Was.
CLAAS is a german family company and a leader in production
of agricultural machinery worldwide, with over 9.000 employees
and turnover of over 3 billion Euro. 14 production plants, a lot of
subsidiaries, among others CLAAS Polska Sp. z o.o., and a wide
sales and service network guarantee direct and close contact to the
company. CLAAS combines have a leading position on the european market, CLAAS forage harvesters are market leaders worldwide.
The product range includes also tractors, round and big square
balers, forage harvesting machinery, telehandlers and the newest
information technology for agricultural management. Please learn
more about the CLAAS highlights for 2011! CLAAS - close to you.
Stoisko: F 302
Claydon
Gaines Hall
CB8 8YA Wickhambrook
Wielka Brytania
tel.: 00 44 (0) 1440 820327
fax: 0044 (0) 1440 820642
e-mail: [email protected]
www.claydondrill.com
Concordia Ubezpieczenia
ul. Św. Michała 43
61-119 Poznań
tel.: +48 61 858 48 00
e-mail: [email protected]
www.concordiaubezpieczenia.pl
Concordia Ubezpieczenia na rynku polskim jest obecna od
1997 roku. W tym czasie uzyskała cenioną pozycję w sferze
ubezpieczeń dla rolnictwa, bankowości spółdzielczej, biznesu
i osób prywatnych. Jako jedno z pierwszych towarzystw
oferuje ubezpieczenia z dopłatami budżetu Państwa. Tworzy
programy ubezpieczeniowe dla dużych gospodarstw oraz pakiety
przygotowane z myślą o Rolnikach indywidualnych. Concordia
to: "Przyjazna Firma Ubezpieczeniowa", "Ubezpieczeniowy Lider
Informatyki Instytucji Finansowych", a także "odpowiedzialny
Pracodawca". Ponadto laureat konkursu "Najlepsze w Polsce" (za
pakiet ubezpieczeń dla rolnictwa "Concordia Agro") i "Najwyższa
Jakość Quality International" (za ubezpieczenie "Życie Plus" oraz
Ochronę Prawną).
Concordia Ubezpieczenia has been operating in the Polish market
since 1997. It has managed to gain an appreciated position in the
sector of insurance for agriculture, cooperative banking, business
and individual customers. It has been one of the first insurance
companies to offer insurance co-funded by the state budget. It
creates insurance programs for large farms and packages prepared for individual farmers. Concordia is a "Friendly Insurance
Company", "Leading Insurer of Financial Institutions IT Systems"
as well as a "Responsible Employer". Moreover, the company is
a laureate of the following competitions: "The Best in Poland" (for
the package of insurance for agriculture referred to as "Concordia
Agro") and "Highest Quality - Quality International" (for "Life Plus"
Insurance and Legal Protection).
Stoisko: C 492
Stoisko: A 170
32
Generalny dystrybutor na rynku polskim: ciągników komunalnych, sadowniczych i rolniczych LS, części zamiennych. Zapewniamy szeroką gamę osprzętu komunalnego oraz profesjonalny
serwis gwarancyjny i pogwarancyjny.
C
CSF Polska
ul. Warszawska 55
35-205 Rzeszów
tel.: +48 17 861 29 19
fax: +48 17 861 19 99
e-mail: [email protected]
Credit Agricole Bank Polska S.A.
pl. Orląt Lwowskich 1
53-605 Wrocław
Infolinia: 801 330 000
www.credit-agricole.pl
Stoisko: D 217
Credit Agricole Bank Polska S.A. - bank uniwersalny, budujący
długoterminowe relacje z klientami: indywidualnymi, małymi i
średnimi firmami, rolnikami oraz przedsiębiorstwami, poprzez
profesjonalne doradztwo i przyjazną obsługę. Bank oferuje
szeroką gamę produktów dla rolnictwa: rachunek bieżący,
kredyty na działalność bieżącą oraz zakup ziemi, lokaty i rachunki
oszczędnościowe.
Credit Agricole Bank Polska S.A. is a universal bank that builds
long-term relations with customers (individuals, farmers, SMEs,
and companies) by providing professional advice and friendly
service. The bank offers a comprehensive range of products for
agriculture: current accounts, working capital loans and loans for
purchase of land, fixed-term deposits, and savings accounts.
Stoisko: F 151
CRYSTAL TRAKTOR Sp. z o.o.
ul. Uniejowska 186
98-200 Sieradz
tel.: +48 43 8271971
fax: +48 43 8271972
e-mail: [email protected]
www.traktor.pl
CWD Sp. z o.o.
spółka dystrybucyjna
Marcinkowo 105
88-330 Gębice
tel.: +48 23 66 26 913
fax: 48 23 66 26 913
e-mail: [email protected]
www.grupa-cwd.pl
Producent i Dystrybutor kotłów na biomasę i paliwa stałe
8kW-1,5MW.
Stoisko: F 481
Czekała s.c.
ul. Spacerowa 65
64-100 Leszno
tel.: +48 606 837 294
fax: +48 65 529 67 33
e-mail: [email protected]
www.czekala-leszno.pl
Stoisko: E 455
DAF AGRO / ANDO TECH Sp. z o.o.
ul. Jażdżewskiego 24
63-000 Środa Wielkopolska
tel.: +48 531 470 184; 691 506 875
e-mail: [email protected]
www.dafagro.com
Firma Crystal Traktor Sp. z o.o. jest producentem ciągników
dla rolnictwa, leśnictwa, służb miejskich i drogowych o mocy
od 114 do 305 KM EURO III, IIIB oraz przy współpracy z
firmą IPS TABOR ciągników szynowo-drogowych o mocy
136 KM. Jesteśmy również jedynym importerem na rynku
polskim tureckich ciągników ArmaTrac o mocy od 50 do 110
KM. Działamy na rynku krajowym i zagranicznym. Obecnie
produkujemy ciągniki pod nazwą handlową ORION, które cechują się nowoczesnymi rozwiązaniami technicznymi. Dzięki
nowoczesnemu parkowi maszynowemu oraz zastosowaniu
specjalistycznych technologii firma Crystal Traktor jest w
stanie sprostać wysokim wymaganiom klientów.
DAF AGRO / ANDO TECH to producent maszyn rolniczych –
wozów paszowych i rozrzutników obornika o wysokiej jakości,
które w pełni zaspokoją oczekiwania odbiorców. W trakcie
procesu budowy maszyn dbamy o jakość i najdrobniejsze
szczegóły. Dysponujemy profesjonalnym zapleczem technicznym
oraz doświadczonym personelem. Nasi sprzedawcy zawsze
starają się znaleźć odpowiedzi na zadane pytania oraz nietypowe
rozwiązania dla wszystkich gospodarstw.
Crystal Traktor Sp. z o.o. is a tractors manufacturer desinged to
agriculture, forestry, municapal and road service with the horse
power between 114 to 305 HP EURO III, IIIB. It also produces
road-railway tractors with the cooperation of IPS TABOR with
the power of 136 HP. Additionally, we are an exclusive importer
of Turkish Armatrac tractors between 50 to 110 HP. We work on
the domestic and international market. Currently, we produce
tractors of trade name ORION, which characterise with modern
technological solutions. Due to advanced machine park and
implemented specialized technologies, Crystal Traktor is able to
meet the highest customers demands.
Stoisko: E 600
Stoisko: D 287
We are honored to introduce you our Company, ANDO TECH Sp.
z o.o. The primary assumption of our Company is to fully satisfy
our Customers’ requirements through professional and nice
services. The Company ANDO TECH Sp. z o.o. specializes in production of feed mixers and spreaders. We specialize also in steel
machining (milling, turning, grinding) and welding. We produce
machines and components according to customer specification.
DALBO A/s
Bindeballevej 69,
DK 7183 RANDBOL, DANIA,
tel.: +45 7588 3500
www.dal-bo.com
Stoisko: A 173
33
Spis wystawców
List of exhibitors
kombajnów oraz innych maszyn rolniczych. Części zamienne
do maszyn uprawowych. Pasy napędowe Optibelt, Gates,
Tagex. Oleje BP, CASTROL, ORLEN, FUCHS, TOTAL. Lampy
ostrzegawcze Sirena i Elektra. Zbiorniki na paliwo.
Damian Firma Handlowo-Usługowo
Poznańska 30a
63-200 Jarocin
tel./fax: +48 62 747 84 60
e-mail: [email protected]
www.fhudamian.pl
Stoisko: D 110
Stoisko: D 543
DanBred International Poland Rafał Klepczyński
Dworcowa 50A/lok 15
86-320 Łasin
tel.: +48 513 145 102
www.danbredint.pl
Stoisko: F 471
Marka rynkowa De Heus Sp. z o.o. powstała z połączenia
dwóch firm mających długie tradycje w sektorze pasz
dla zwierząt. Obecnie jest wiodącym producentem pasz
pełnoporcjowych, koncentratów, premiksów oraz preparatów
mlekozastępczych w Polsce. Firma należy do Grupy De Heus
- największej niezależnej firmy rodzinnej wytwarzającej pasze
na rynku holenderskim.
DANBUD Daniel Piasecki
PRODUKCJA I HANDEL
MASZYNY ROLNICZE
Moszczanka 56a, 08-500 Ryki
(trasa Warszawa-Lublin)
tel.: +48 513 22 00 11
fax: +48 81 865 61 50
www.danbudryki.pl
Jesteśmy polską, prężnie rozwijającą się firmą o zasięgu
ogólnopolskim. Zajmujemy się produkcją sprzętu rolniczego
oraz wykonujemy usługi dla branży rolniczej. Zapraszamy
do współpracy!! Producent: sprzętu rolniczego: ładowaczy
czołowych TUR (do każdego modelu ciągnika!) – 3sekcyjny,
samopoziomujący, gwarancja, montaż gratis! solidna konstrukcja, joystick, pełna hydraulika, mocowanie EURO, udźwig
1600kg! Wysokość podnoszenia do 4m, szybki montaż!
Osprzętu: łyżki, chwytaki, krokodyle, widły, pługi paleciaki i
inne. Usługi: wycinanie elementów (blacha 3-50 mm) super
ceny! Wykonanie produktów nietypowych!
Stoisko: E 573
DANKO Hodowla Roślin Sp. z o.o.
Choryń 27
64-000 Kościan
tel.: +48 65 513 48 13
fax: +48 65 513 48 06
e-mail: [email protected]
www.danko.pl
Stoisko: B 357
DAV D. A. VOGEL
ul. Ozimska 184
46-020 Opole
tel.: +48 77 458 07 46
fax: +48 77 457 66 59
e-mail: [email protected]
www.dav.opole.pl
Oddział Wrocław:
ul. Tarnogajska 5, 50-426 Wrocław
tel.: +48 71 782 84 66
e-mail: [email protected]
Filtry do wszystkich typów maszyn rolniczych i budowlanych.
Filtry firmy Fleetguard i Techfilter oraz oryginalne i zamienniki innych producentów. Łańcuchy firmy Iwis Flexon do
34
De Heus Sp. z o.o.
ul. Lotnicza 21 B
99-100 Łęczyca
tel.: +48 24 721 04 00
fax: +48 24 721 04 04
www.deheus.pl
De Heus Sp. z o.o. Trade Mark came into existence from
connecting two companies having long experience in the feed
sector. Nowadays the company is the leading producer of
compound feeds, concentrates, premixes and milk replacers
in Poland. The company belongs to the De Heus Group – the
biggest independed family company producing feed in a
Dutch market.
Stoisko: B 348
DEFALIN GROUP S.A. Przedsiębiorstwo Produkcyjno
Handlowo Usługowe
ul. Towarowa 16
58-160 Świebodzice Poland
tel.: +48 74 854 99 00 / 28
fax: +48 74 854 99 02 / 29
e-mail: [email protected]
internet: www.defalin.com.pl
DEFALIN GROUP SA to największy producent wyrobów
powroźniczych. Producent doskonałej jakości, znanych i
sprawdzonych na polskim rynku polipropylenowych sznurków
rolniczych HEROS, GOLIAT, TYTAN, ATLAS, GIGANT, sznurków opakowaniowych oraz sznurków wykorzystywanych w
ogrodnictwie i na plantacjach chmielu. Firma posiada w ofercie: linki PP, ogrodzeniowe linki PP oraz taśmy opakowaniowe
PP. DEFALIN ZWIĄŻE NAJPEWNIEJ.
DEFALIN GROUP SA company is the biggest manufacturer of
many sorts of the best quality twines and ropes. HEROS, GOLIAT, TYTAN, ATLAS and GIGANT polyprophylene agriculture
twines are well known and accepted on the Polish market as
well as the packaging twines and twines used in gardening
and in hop's plantations. PP ropes, PP fence ropes and PP
strapping tapes are also offered by Defalin. DEFALIN CAN
BIND THE BEST.
Stoisko: C 518
D
Caterpillar®, Hanomag®, Liebherr®, Case®, John Deere®,
MWM®, Leyland®, David Brown®, Ford®
Przedsiębiorstwo Wielobranżowe DEFRO
Robert Dziubeła
Ruda Strawczyńska 103 A
26-067 Strawczyn
Największy producent kotłów c.o. na paliwa stałe w Polsce.
We are a direct importer of engine parts and a distributor
of Pro Parts Diesel. We have replacement parts suitable
for engines: Deutz®, Perkins®, Cummins®, Komatsu®,
Caterpillar®, Hanomag®, Liebherr®, Case®, John Deere®,
MWM®, Leyland®, David Brown®, Ford®
Stoisko: D 552
Ets DENIS
Avenue Louis-Denis
28160 Brou - France
tel.: 0033 237 97 66 11
fax: 0033 237 97 66 40
e-mail: [email protected]
www.denis.fr
Stoisko: D 84
Ditta-Seria
Dieci Polska
Żdżary 75A
26-420 Nowe Miasto nad Pilicą
tel.: +48 48 674 41 71
kom.: +48 508 091 997
e-mail: [email protected]
www.dieci.pl
Mechaniczny transport ziarna i mąki do 300 ton na godzinę.
Stoisko: E 298
P.P.H.U. DEXWAL BIS
Wojska Polskiego 4
28-100 Busko-Zdrój
tel.: +48 41 378 70 11
fax: +48 41 378 70 19
e-mail: [email protected]
Firma Ditta Seria działa na polskim rynku od 1992 r. Jej
działalność obejmuje produkcję: konstrukcji stalowych (hale,
wiaty), zbiorników kwasoodpornych, wag i wywrotnic samochodowych, maszyn sadowniczych. Ponadto firma Ditta Seria
jest Dystrybutorem ładowarek teleskopowych firmy DIECI dla
rolnictwa i budownictwa.
Stoisko: D 216
Stoisko: E 588
DIUNA Sp.j.
Piotr Drabiński, Jerzy Wyporkiewicz
ul. Szajnochy 3
85-738 Bydgoszcz
tel.: +48 52 345 32 98
fax: +48 52 345 32 98 wew. 28
e-mail: [email protected]
www.diuna.pl
DIECI S.R.L.
VIA E. MAJORANA, 2-4
42027 Montecchio Emilia (RE) Italy
tel.: +39 0522 869611
fax: +39 0522 869798
Stoisko: F 133
Dieci firma specjalizująca się w produkcji ładowarek teleskopowych z najszerszą na świecie gamą produktów! Maszyny
produkowane przy wykorzystaniu najlepszych komponentów
dostępnych na rynku oferowane na szczególnie korzystnych
warunkach cenowych.
Dieci is a company that specialises in production of telescopic
handlers with the widest range in the world! Machines produced with the best component available on the market, offered
in a very good price.
Stoisko: F 304
DIESEL CZĘŚCI – hurtownia części silnikowych
ul. Wróblewskiego 90/92
94-103 Łódź
tel.: +48 42 683 13 38
e-mail: [email protected]
www.diesel-czesci.pl
Jesteśmy bezpośrednim importerem części silnikowych oraz
dystrybutorem marki Pro Parts Diesel. Posiadamy zamienniki
do silników: Deutz®, Perkins®, Cummins®, Komatsu®,
DLG AgroFood Sp. z o.o.
ul. Obornicka 229
60-650 Poznań
tel.: +48 61 639 01 17/18
e-mail: [email protected]
www.dlg-agrofood.pl
www.opolagra.pl
www.targiferma.com.pl
DLG AgroFood stanowi platformę dla międzynarodowych
kontaktów. Celem Firmy jest wspieranie polskiej gospodarki
rolnej i żywnościowej oraz rozpowszechnianie wiedzy z
sektora rolniczego. Poprzez organizację targów, konferencji
i szkoleń oraz współpracę z doświadczonymi partnerami
polskimi i niemieckimi wdrażamy nasze cele w życie. DLG
AgroFood jest spółką-córką DLG – wiodącej organizacji z
sektora gospodarki rolnej i żywnościowej w Niemczech.
DLG jest politycznie neutralną i finansowo niezależną
organizacją specjalistyczną, zrzeszającą ponad 22.000
członków na całym świecie. Nasze projekty: Opolagra
35
Spis wystawców
List of exhibitors
– największa w południowej Polsce wystawa rolnicza z
pokazami pracy maszyn i aukcją bydła, Kamień Śląski
k. Opola; Międzynarodowe Targi Ferma w Atlas Arena w
Łodzi – infrastruktura hodowli zwierząt; Dni Przedsiębiorcy
Rolnego; Agro-Tech wystawa rolnicza, Minikowo; Centrum
Techniki Rolniczej w Minikowie; wyjazdy studyjne na
wystawy DLG na całym świecie.
Stoisko: B 353
Uzyskiwane z przemiału surowego dolomitu do uziarnienia
0-2mm, zawartość tlenków wynosi: CaO + MgO min. 45%, w
tym MgO 18-20%, CaO 30-32%, posiadamy świadectwo do
stosowania Wapna w rolnictwie ekologicznym.
Our Company is miting and processing dolomite for building
industry Road making, and Fertilising lime, which contains
magnesium (variety05). It is obtained in the raw dolomite
breaking process to produce 0-2 mm grain, and composition
calculated in oxides is as follows: CaO+MgO-minimum 45%,
including 18-20% of MgO and 30-32%of CaO. We have the
certificate for use in ecological farming for our product.
dmps P. Drews, M. Mańkowski s.c.
ul. Targ Rybny 1/10
70-535 Szczecin
Stoisko: hala 13
Stoisko: E 572
DOBROWOLSKI Maszyny Rolnicze
ul. Kurowskiego 8
62-504 Konin
tel.: +48 604 993 455
fax: +48 63 245 72 10
e-mail: [email protected]
www.dobrowolski.agro.pl
Stoisko: C 71
Dolzamet Sp. z o.o.
Fabryka Łańcuchów
ul. Fabryczna 1
59-225 Chojnów
e-mail: [email protected]
www.dolzamet.pl
DOLFOS Sp.J.
ul. Gliniana 6
97-300 Piotrków Trybunalski
tel./fax: +48 44 616 30 51, 44 616 31 51
e-mail: [email protected]
www.dolfos.com.pl
DOLZAMET Sp. zo.o., Fabryka Łańcuchów jest producentem
łańcuchów napędowo-rolkowych, rolniczych, płytkowych,
transportowych i specjalnych. Nasze produkty i usługi
znajdują zastosowanie w przemyśle motoryzacyjnym, zbrojeniowym, maszynowym, rolnictwie, budownictwie i przemyśle
drzewnym. Produkowane łańcuchy spełniają wymagania
norm PN, DIN, ANSI.
Firma produkuje mieszanki paszowe uzupełniające dla wszystkich gatunków zwierząt, jak również: preparaty mlekozastępcze dla cieląt, prosiąt, źrebiąt; wlewy żelowe i energetyczne
lizawki mineralno-witaminowe dla bydła; preparaty stymulujące ruję (krowy, lochy); rozpuszczalne w wodzie mieszanki
witaminowe dla drobiu.
Dolzamet Ltd., Chain Factory is manufacture of driving-roller,
chains, chains for agricultural applications, plate link chains,
conveying chains and special. Our products are used in mechanical, defense, agriculture, building and wood processing
industry. Chains made by the factory comply with PN, DIN
and ASNI standards.
Stoisko: D 93
Company produces supplementary foodstuff blends for all
animal species as well as: milk substitutes for calves, piglets,
foals; gel products applied into the mouth and energetic licks
with minerals and vitamins for cattle; products stimulating
estrus (for cows, sows); soluble vitamin mixes for poultry.
Stoisko: B 343
P.P.H.U Dolomit Kopalnia Ząbkowice S.A.
ul. Dolomitowa 6
42-520 Dąbrowa Górnicza
tel.: +48 32 639 07 10, 32 639 07 27
fax: +48 32 639 07 13
e-mail: [email protected], [email protected]
www.dolomit.com.pl
Przedsiębiorstwo prowadzi wydobycie i przetwórstwo dolomitu na kruszywa budowlane i drogowe oraz wapno nawozowe
zawierające magnez (odmiana 05)
36
P.W. DOMIX Tomasz Dobrychłop
Kawnice-Kolonia 8C, 62-590 Golina
tel.: +48 63 890 90 74, 697 013 128
fax: +48 63 244 78 12
e-mail: [email protected]
www.sklep.domix-agro.pl
Sprzedaż detaliczna i hurtowa części zamiennych do maszyn
rolniczych.
Retail sales and wholesale of spare parts for agricultural
machinery.
Stoisko: F 166
D
DUO PLAST jest czołowym producentem innowacyjnych folii
do pakowania na rynku i posiada dwa nowoczesne zakłady
produkcyjne w Niemczech. Folie stretch do sianokiszonki
DUO PLAST produkowane są według opatentowanej formuły
i zapewniają najwyższą jakość paszy. Na Agro Show, firma
zaprezentuje swoje główne marki z działu DUO AGRO: DUO
7PLUS XL, DUO 7PLUS, DUO 3PLUS, DUO OPTIMA, DUO
FUTURA, SILAFOL
Dozamech
Donat Zawidzki
ul. Strzelecka 49
63-430 Odolanów
tel.: +48 62 733 23 22
fax: +48 62 733 27 88
e-mail: [email protected]
www.dozamech.com.pl
DOZAMECH producent: mieszalników pasz sypkich;
rozdrabniaczy ssącoo-tłoczących; dozowników wagowych
mechanicznych i elektronicznych; dmuchaw ssąco-tłoczących
do zboża; podajników ślimakowych skośnych i pionowych;
wanien rozładowczo-załadowczych do zboża; przewoźnych
suszarni ziarna; wybieraków kiszonek.
DUO PLAST is a leading, innovative manufacturer in the
packaging film market and has two modern production sites
in Germany. Silage stretch films made by DUO PLAST are
produced according to a patented formula and stand for
highest forage quality. At Agro Show, the company presents
its main brands of the business unit DUO AGRO: DUO
7PLUS XL, DUO 7PLUS, DUO 3PLUS, DUO OPTIMA, DUO
FUTURA, SILAFOL.
Stoisko: D 563
DOZAMECH produce: Loose feed mixers; Suction&force grain
mills; Weight feeders; Pneumatic grain elevators; Transport
augers; Grain dryer; Silage jaw selector.
Stoisko: C 403
DRZEWICZ - Wytwórnia Suszarń K. Rokicki
Stary Drzewicz 1
96-315 Wiskitki
tel./fax: +48 46 856 73 11
e-mail: [email protected]
www.drzewicz.com.pl
Suszarnie do ziarna: stacjonarne i przewoźne, opalane gazem
ziemnym, propan-butanem, olejem opałowym lub biomasą.
Szeroki wybór modeli. Dysponujemy 17-letnim doświadczeniem w produkcji suszarń do ziarna.
Grain dryers: stationary and mobile, heated with natural gas,
propane-butane, heating oil or biomass. Large selection of
dryer models. We have been manufacturing dryers for over
17 years.
Stoisko: D 415
Dual System
ul. gen. Józefa Bema 29
65-170 Zielona Góra
tel.: +48 68 323 13 68
e-mail: [email protected]
www.dualsystem.com.pl
Stoisko: F 255
DUO PLAST AG
ul. Modlińska 190A
03-119 Warszawa
tel.: +48 22 510 36 97
fax: +48 22 510 36 98
e-mail: [email protected]
www.duoplast.ag
DURO-FRANCE
www.duro-france.com
Importer w Polsce
Agri-Consult
Ryczeń 6
56-200 Góra
kom.: +48 691 401 914, 603 941 378
e-mail: [email protected]
www.agri-consult.pl
Firma DURO-FRANCE cieszy się niezawodną reputacją w
dziedzinie maszyn rolniczych. Z fabryki wychodzi cała gama
maszyn do upraw odpowiadająca aktualnym potrzebom
rynku, tj: głębosz, strip-till,agregat uprawowy compil. Firma
Agri-Consult jest polskim importerem maszyn DURO-FRANCE. Firma powstała z myślą o potrzebach rolnika.
Świadczymy profesjonalne usługi i doradztwo w zakresie
agrotechniki. Wprowadzamy w życie nowoczesne techniki
uprawy UTU, przy zachowaniu jak najwyższej jakości usług,
obniżamy koszty utrzymania gospodarstwa. Stosujemy system produkcji stabilny i długoterminowy, poprzez poprawę
życia glebowego. Doradzamy rolnikom w jaki sposób dojść
do takiego systemu. W celu pogłębienia informacji na temat
Uproszczonej Techniki Uprawy zapraszamy na stronę internetową: www.rolnictwo-utu.pl.
The DURO-FRANCE factory supplies a whole range of
agricultural machines for cultivation, including subsoiler,
strip-till, and compil cultivation unit. The company Agri-Consult is a Polish importer of these machines. We provide
professional agrotechnical services and counselling. We
implement modern simplified cultivation techniques. Our
production process is stable and long-term, by improving
quality of soil life. Please, visit our website: www.rolnictwo-utu.pl.
Stoisko: D 213
37
Spis wystawców
List of exhibitors
Dystrybutor produkowanych od blisko 20 lat nowoczesnych,
szczelnych przyczep rolniczych trzystronnego wywrotu w wielu wersjach konstrukcyjnych, dostarczanych na rynki Europy
Zach. i krajowy. Producentem ich jest będąca członkiem tej
samej grupy kapitałowej firma POM-EKO Sp. z o.o. w Szczecinku. Dostarczamy także kontenery stalowe, przenośniki
taśmowe i konstrukcje stalowe.
EcoJura Sp. z o.o.
ul. 1 Maja 4
42-202 Częstochowa
tel.: +48 34 374 03 73
fax: +48 34 310 30 48
e-mail: [email protected]
Jesteśmy czołowym polskim producentem płaskich kolektorów słonecznych, dystrybutorem i wykonawcą instalacji
fotowoltaicznych. Nasze wyroby spełniają wymagania norm
PN-EN 12975-2006, 2007 i posiadają międzynarodowy certyfikat Solar Keymark. Dysponujemy pełną ofertą dotyczącą instalacji słonecznych oraz całym asortymentem dodatkowym.
Oferujemy również kompletne systemy fotowoltaiczne.
We are a leading producer of the flat solar panels in Poland
and the distributor of photovoltaic systems. Our products
meets the PN-EN 12975-2006, 2007 norms requirements.
Additionally, they have the international Solar Keymark certificates. We have a full range of solar systems and entire range
of accessories. Also we offer complete photovoltaic systems.
Stoisko: E 611
Efipol Sp. z o.o.
Wałcz Drugi nr 1
78-600 Wałcz
tel.: +48 608 413 695
e-mail: [email protected]
Stoisko: E 440
Distribution company of the most up-to-date leak-resistant
three-way tipping agricultural trailers in many constructional
version. For almost 20 years these trailers have been manufacturing and delivering to the Western European and domestic market. The manufacturer of these trailers is POM-EKO
Sp. z o.o. the member of the same capital group. We offer
also: steel containers, belt conveyors and steel constructions.
Stoisko: E 237
EKO – ROL Rogowo
ul. Jeziorna 3
88-420 Rogowo
tel.: +48 52 302 40 47
fax: +48 52 302 45 29
e-mail: [email protected]
www.ekorol.com
Jesteśmy producentem wyposażeń wnętrz budynków inwentarskich. Działamy od 1973 roku, zdobywając w tym czasie
doświadczenie i uznanie na rynku. W naszym asortymencie
produkcyjnym należy wyróżnić: kojce porodowe, kojce
indywidualne, przegrody żywieniowe, koryta, przegrody legowiskowe dla bydła, wiązania, drabiny paszowe, bramy przepędowe. Wszystkie wyżej wymienione produkty wykonane są ze
stali ocynkowanej ogniowo.
Unsere Firma ist auf dem Markt seit 1973. Wir sind tätig als
Hersteller von Stahlkonstruktionen. Seit 1995 ist Stalleinrichtung das Hauptgebiet unserer Produktion. Wir fertigen u.a.
Liegeboxabtrennungen, Selbstfangfreßgitter, Abferkelbuchten,
Sauenstände, Teleskoptore, Pferdeboxen u.a. Wir können auch
Sonderaufträge durchführen. Über 80% der Gesamtproduktion
verkaufen wir nach Westen, hauptsächlich nach Deutschland.
Przedsiębiorstwo Ekologiczne Ekoflora
Siewielec Tadeusz
Kolejowa 14
23-200 Kraśnik
tel.: +48 81 825 20 25
fax: +48 81 825 20 85
e-mail: [email protected]
www.ekoflora.com.pl
Stoisko: E 435
stoisko: E 577
Eko-Hurt Artur Penkala
ul. Szpitalna 15
63-300 Pleszew
tel.: +48 606 297 874
fax: +48 62 742 71 22
e-mail: [email protected]
www.eko-hurt.pl
Stoisko: D 567
EKO-INVEST Sp. z o.o.
ul. Pilska 4-6
78-400 Szczecinek
tel.: +48 94 374 26 11
fax: +48 94 374 31 65
kom.: +48 692 426 175, 692 424 790
e-mail: [email protected]
www.eko-invest.com.pl
38
EKOTRONIC
ul. Mieszka I 4/14
42-500 Będzin
tel./fax: +48 32 360 22 44, 761 84 84
kom.: +48 601 704 215
LECHLER - znany z jakości poducent rozpylaczy rolniczych,
sadowniczych oraz osprzętu do opryskiwaczy. Rozpylacze
płaskostrumieniowe, standardowe ST, uniwersalne LU,
antyznoszeniowe AD, eżektorowe ID, IDK, dwustrumieniowe
DF, wirowe TR, ITR. Polimer, stal, ceramika. Międzynarodowe
atesty, najwyższa jakość wykonania, precyzyjna aplikacja
środków ochrony roślin. Wyłączny importer: Ekotronic.
LECHLER – recognised producer of high quality spraying
machines for farms and orchards, and fittings for spraying
E
machines. Flat jet, standard ST, general purpose LU, anti-drift
AD, ejector ID and IDK, double-jet DF, impeller TR and ITR
spraying machines. Polymer, steel and ceramics. Exclusive
importer: Ekotronic.
Manufacturer of a wide range of material handlings, silage
defacers, silage mixer feeder buckets, concrete mixer buckets,
sweepers. New: Straw bale feeders / spreaders.
Stoisko: E 298
Stoisko: C 281
EMMAROL Sp. z o.o,
76-200 Słupsk
ul. Przemysłowa 100
www.emmarol.pl
Dział Sprzedaży:
tel.: +48 59 841 80 43
fax: +48 59 841 70 28
e-mail: [email protected]
Elteco Poland Sp. z o.o.
ul. Pilotów 2
31-462 Kraków
tel.: +48 12 623 33 00-05
fax: +48 12 623 33 22
e-mail: [email protected]
Dział handlowy:
tel.: +48 12 623 33 00-05
fax: +48 12 623 33 22
e-mail: [email protected]
Dział techniczny / serwis:
tel.: +48 12 623 33 23, 12 623 33 25
fax: +48 12 623 33 22
e-mail: [email protected]
Firma EMMAROL od 2007 r. zajmuje się produkcją hederów
do kukurydzy na ziarno w zakresie 6, 8 i 12 rzędów. W 2010
roku wprowadzono do sprzedaży hedery w zakresie 4 oraz 5
rzędów, natomiast w 2013 r. hedery 6 i 8-rzędowe w wersji z
ramą sztywną.
Stoisko: E 118
ELTECO POLAND Sp. z o.o. jest filią słowackiego koncernu
ELTECO a.s. specjalizującego się w systemach kogeneracyjnych oraz urządzeniach bezprzerwowego zasilania. DOSTARCZAMY kompletne systemy zasilające z pełnym sterowaniem
i monitoringiem. Nasze produkty i systemy są stosowane: w
biogazowniach; w przemyśle w procesach produkcyjnych i
jako układy zasilania; przy zasilaniu systemów sterowniczych.
ELTECO Poland Sp. of o.o. is a part of the Slovak company
ELTECO a.s. specializes in CHP systems and uninterruptible
power supply devices. We Provides a complete power systems
with full control and monitoring. Our products and systems are
used: In biogas installations. In industrial production processes
and as a power supply systems. In the power control systems.
Stoisko: E 452
Elwa Sp. j.
A. Pałczyński, D. Frelak
ul. Paderewskiego 48
05-520 Konstancin-Jeziorna
tel.: +48 602 448 029
fax: +48 22 754 16 15
e-mail: [email protected]
www.borner.pl
Emplex Sp. z o.o.
ul. Przemysłowa 1
62-400 Słupca
tel.: +48 63 275 19 26
fax: +48 63 275 18 59
e-mail: [email protected]
www.emplex.pl
Stoisko: D 88
Enatruck
ul. Dworcowa 32
83-000 Pruszcz Gdański
tel.: +48 58 300 96 00
fax: +48 58 300 96 39
e-mail: [email protected]
www.enatruck.pl
Akcesoria do maszyn rolniczych, leśnych, budowlanych i
pojazdów ciężarowych.
Stoisko: C 597
Stoisko: C 399
EMILY
Za Les Landes
29800 Tréflévenez Francja
tel.: +33 2 98 21 86 12
kom.: +33 (0)6 34 61 62 74
www.ubifrance.fr
Producent szerokiej gamy akcesoriów (do traktorów,
ładowarek teleskopowych i kompaktowych), łyżki z wirnikiem
do cięcia kiszonki, łyżki do cięcia, mieszania i dystrybucji
kiszonki, łyżki do mieszania betonu, zamiatarki. Nowość:
Maszyny do ścielenia słomy i zadawania paszy.
Endress Polska Sp. z o.o.
ul. Roosvelta 2
66-440 Skwierzyna
tel.: +48 95 717 33 13
fax: +48 95 717 33 14
e-mail: [email protected]
www.endress-polska.pl
Stoisko: F 163
ENERGETYCZNE CENTRUM S.A.
ul. Graniczna 17
26-604 Radom
tel.: +48 801 450 550
fax: +48 48 685 50 79
e-mail: [email protected]
www.ec.net.pl
Stoisko: E 593
39
Spis wystawców
List of exhibitors
Energetyk – Serwis Sp. z o.o.
ul. Obrońców Stalingradu 29
45-594 Opole
Tel./fax +48 77 453 50 48
e-mail: [email protected]
www.agrosulca.pl
Energetyk Serwis z Opola oferuje najtańsze źródło siarki na
polskim rynku pod nazwą AgroSulCa (nawóz siarkowo-wapniowy) i UTX-2n (nawóz siarkowo-wapniowo-magnezowy)
oraz dodatki paszowe, a szczególnie Zeofirex do zwalczania
mikotoksyn i odorów. Zajmujemy się także sprzedażą zbiorników na paliwo, sprzedażą ON. Oferujemy również uniwersalne
rozsiewacze i przyczepy.
Energetyk Serwis from Opole offers the cheapest source of
sulfur on the Polish market, under the names: AgroSulCa
(sulfur-calcium fertilizer) and UTX-2n (sulfur-calcium-magnesium). Moreover, we offer feed additives – especially
Zeofirex for combating with mycotoxins and odors. As well we
are selling fuel tanks and ON. In our offer are also universal
fertilizer spreaders and trailers.
Energo-System Zakład Kotlarski
Roman Gielniak
ul. Kaliska 91
63-300 Pleszew
tel.: +48 62 508 30 66, 62 508 30 88
EURALIS Saaten Sp. z o.o.
Oddział w Polsce
ul. Wichrowa 1a
60-449 Poznań
tel./fax: +48 61 8449 140
e-mail: [email protected]
EURALIS Saaten Sp. z o.o. Oddział w Polsce to polskie przedstawicielstwo firmy hodowlanej EURALIS Semences S.A.S., należącej do francuskiej Groupe EURALIS. Specjalizujemy się w hodowli
i produkcji materiału siewnego kukurydzy, rzepaku i słonecznika, a
także soi i sorga. Więcej na stronie internetowej www.euralis.pl
EURALIS Saaten Sp. z o.o. Oddział w Polsce is the Polish
representation of the breeding company EURALIS Semences S.A.S., belonging to the French Groupe EURALIS. We
specialize in breeding and seed production of maize hybrids,
rapeseed and sunflower, as well as soybeans and sorghum.
More on website www.euralis.pl
Stoisko: B 374
Stoisko: D 565
EUROAGRICOLA ANDRES
Juan Jose Andres Martinez
ul. Mokotowska 27 m.6
00-560 Warszawa
tel./fax: +48 22 623 84 89
e-mail: [email protected]
www.euroagricola.com
Euroagricola Andrés to firma z 40 letnim doświadczeniem w
sektorze używanych i nowych części zamiennych ciągników.
Od 11.2012 dzięki naszym nowym oddziałowi w Polsce
zajmujemy się również w rynkach krajów Europy Wschodniej.
Dysponujemy szerokim asortymentem: układy planetarne,
koła talerzowe i wałki atakujące, zwrotnice, obudowy, zebątki,
itd pasujące do marek JD, NH, Case, Same, Fiat, Deutz, itd
ERG Bieruń–Folie Sp. z o.o.
ul. Chemików 163
43-150 Bieruń
tel.: +48 32 466 13 40
fax: +48 32 466 13 59
e-mail: [email protected]
www.ergbierunfolie.pl
Stoisko: C 514
Euroagricola Andrés is a company with more than 40 years
of experience in the sector of used and new spare parts for
tractors. From 11.2012 we are also in Eastern Europe thanks
to our new office in Poland. We offer a wide range of spare
parts such as ring and pinion sets (front and back), planetary
assemblies, engines, clutches, gear boxes, etc. adaptable to
JD, NH, Case, Same, Fiat, Deutz, etc.
Erich Stallkamp Polska Sp. z o.o.
Noskowo 1
76-122 Wrześnica
tel.: +48 59 810 75 91
fax: +48 59 810 70 41
e-mail: [email protected]
www.stallkamp.pl
Stoisko: hala 29
Firma jest kompetentnym partnerem w rozwiązywaniu problemów z płynnymi odchodami zwierzęcymi. Fachowo i kompleksowo doradzamy i dostarczamy urządzenia do usuwania,
składowania i separowania odchodów zwierzęcych. W naszej
ofercie posiadamy pompy, mieszadła, zbiorniki ze stali nierdzewnej oraz separatory. Jesteśmy również przedstawicielem
Firmy WELtec BioPower, wiodącego producenta biogazowni.
Stoisko: F 482
40
Europejski Fundusz Leasingowy SA
pl. Orląt Lwowskich 1
53-605 Wrocław
Infolinia: 0801 677 666
www.efl.pl
EFL to firma finansowa aktywnie wspierająca rozwój polskiej
przedsiębiorczości. Oferuje szeroki pakiet produktów, w tym
dedykowany Rolnikom pakiet Agrolinia, w skład którego wchodzą leasing i pożyczka. EFL w swoich strukturach posiada sieć
dedykowanych doradców Agro. Firma od 2001 roku wchodzi
F
w skład Grupy Credit Agricole, jednej z największych pod
względem wielkości kapitału instytucji finansowych na świecie.
EFL is the financial company, actively supporting the polish
entrepreneurship development. EFL offers comprehensive
package of products, including Agrolinia package with leasing
and loan, targeted to farmers. EFL in its structure has a
network of dedicated advisors of Agro. Since 2001 EFL is
a part of Credit Agricole Group, one of the biggest financial
institutions in the world in terms of capital.
Stoisko: F 151
EUROPLANT Handel Ziemniakami Sp. z o.o.
Obliwice, Aleja Topolowa 1
84-351 Nowa Wieś Lęborska
Oddział Laski Koszalińskie 3A
76-039 Biesiekierz
tel.: +48 94 347 34 61
fax: +48 94 347 34 62
kom.: +48 602 606 233, 608 619 440
Biuro w Nysie: +48 602 500 723, 664 476 782
e-mail: [email protected]
www.europlant.pl
fax: +48 24 252 34 13, 252 16 50 dział marketingu i handlu
kom.: +48 605 540 287 - Leszek Weremczuk
- dyrektor ds. marketingu i handlu
e-mail: [email protected]; [email protected]
www.expom.eu
Niezawodny partner każdego rolnika. Produkcja i sprzedaż
maszyn i urządzeń rolniczych: agregaty do upraw przedsiewnych „Lech” i „Wicher”,agregaty ścierniskowe „Grom”, agregaty
podorywkowe „Ajax”, - agregaty talerzowe „Goliat”, wały
uprawowe składane hydraulicznie „Jacek”, „Tytan”, „Maximus”,
wały campbell crosskill współpracujące z pługami obracalnymi
„Partner”wały uprawowe cambridge i crosskill na przedni i
tylny TUZ ciągnika „Uniwersal”, wały campbell na przedni TUZ
ciągnika ”Progress” i „Terra I”, spulchniacze - chwastowniki
„Aktywator”, włóki łąkowo-polowe „Niwa”, wały łąkowe „Mors”,
chwytaki do okrągłych i kwadratowych bel słomy i siana,
skrzynie ładunkowe, widły do obornika, szufle do materiałów
sypkich, brony mulczowe „Tajfun”. NOWOŚCI: agregat do upraw
przedsiewnych „Tornado” oraz kultywator polowy „Gryf”.
Presowing cultivation units, subsoil parking units, campbell
rollers, cambridge and crosskill land rollers, pulled, hydraulic
folding, campbell rollers front mounted, meadow rollers,
- meadow field drags, cultivator weeders for ecological
cultivation, grab and forks for round and rectangular bales,
packing boxes.
Stoisko: C 276
Producent wysokiej jakości sadzeniaków poszukiwanych
odmian: VIVIANA, KRASA, COLETTE, NANDINA, VINETA, RED
SONIA, ROSALIND, BELLAROSA, RED FANTASY, AUGUSTA, JELLY, EWELINA, SATURNA, OMEGA,, EUROSTARCH,
ZUZANA, DANUTA, HONORATA, JURATA. Nasze odmiany
charakteryzuje wyśmienity smak, wysoki plon (pow. 40t/ha),
wierność plonowania, dobre cechy przechowalnicze.
A producer of high-quality seed potatoes of renowned varieties: VIVIANA, KRASA, COLETTE, NANDINA, VINETA, RED
SONIA, ROSALIND, BELLAROSA, RED FANTASY, AUGUSTA,
JELLY, EWELINA, SATURNA, OMEGA,, EUROSTARCH,
ZUZANA, DANUTA, HONORATA, JURATA. Our varieties are
characterised by excellent taste, high crop (exceeding 40 t/
ha), consistent yield, and good storage parameters.
Stoisko: B 372
EWPA - Maszyny Budowlane Sp. z o.o.
ul. Poznańska 152
62-052 Komorniki
tel.: +48 61 810 75 13
fax: +48 61 810 82 80
e-mail [email protected]
www.ewpa.pl
Stoisko: D 219
Fabryka Wag Kalisto Sp. z o.o.
ul. Inowrocławska 12
88-170 Pakość
tel./fax: +48 52 345 69 18
e-mail: [email protected]
www.kalisto.pl
Fabryka Wag Kalisto jest producentem wag samochodowych
z pomostem betonowym lub stalowym oraz wag osiowych
przeznaczonych do pomiarów statycznych lub dynamicznych.
Kalisto posiada uprawnienia do legalizacji swoich wag oraz
znakowania CE. Własny program komputerowy Waga Pro
służy do obsługi wagi i jej urządzeń peryferyjnych (kamery,
szlabany, światła, czytniki kart, tablet). Serwis krajowy 48 h.
Fabryka Wag Kalisto is a steel and concrete truck scale and
dynamic and static axle scale producer also active in a field of
preparing own software solutions for managing scales and scale`s peripherals like CCTV night cameras, barriers, traffic lights,
card readers and iPads. National service reaction time – 48 h.
Stoisko: D 431
EXPOM Sp. z o.o.
ul. Parkowa 2
99-340 Krośniewice
tel.: +48 24 252 30 03, 252 43 06
FARESIN INDUSTRIES SPA
VIA DELL’ARTIGIANATO 36
36042 Breganze
Włochy
41
Spis wystawców
List of exhibitors
tel.: +39 0445 800 300
fax: +39 0445 800 340
e-mail: [email protected]
www.faresindustries.com
Stoisko: C 207
Farmer, farmer.pl, gieldarolna.pl
wydawca
Polskie Towarzystwo Wspierania Przedsiębiorczości S.A.
ul. Piotra Ściegiennego 3
40-114 Katowice
tel.: +48 32 209 13 03
e-mail: [email protected]
www.farmer.pl
Miesięcznik Farmer oraz portal farmer.pl adresowane są
do osób zainteresowanych problematyką rolnictwa i wsi,
biznesem wiejskim oraz branżą rolno-spożywczą. Farmera
tworzą stałe działy: agrotechnika, technika rolnicza, prawo,
ekonomia i rynek oraz budownictwo na wsi. Dla hodowców
przeznaczona jest Ferma. farmer.pl to znakomita baza informacji rolniczych i wiedzy o rolnictwie. W ramach portalu jest
dostępna również gieldarolna.pl.
Stoisko: C 377
Farmer Sp. z o.o.
Producent Ciągników Rolniczych
ul. Białostocka 200
16-100 Sokółka
tel.: +48 85 711 01 00
tel./fax: +48 85 711 01 01
e-mail: [email protected]
www.farmer.net.pl
Stoisko: C 204
Farmet a. s.
JiĜinková 276
552 03 ýeská Skalice
Czechy
tel.: +420 491 450 111
kom.: +420 774 715 738
e-mail: [email protected]
www.farmet.pl
Producent nowoczesnych i ekonomicznych ciągników
rolniczych z napędem na 2 i 4 koła o mocy od 33 do 110
km w wersji kabinowej i z ramą ochronną, posiadających
homologację europejską, wyposażonych w silniki PERKINS
oraz układy napędowe ZF i CARRARO.
Producer of modern and economical agricultural tractors, 2&4
wheel drive, power from 33 to 110 hp, rops & cabin version,
PERKINS engines, ZF & CARRARO transmisions, european
homologation.
Stoisko: F 301
FarmTrade
Wolska 55A
05-119 Stanisławów Drugi
tel.: +48 22 499 55 24
fax: +48 22 499 55 25
e-mail: [email protected]
www.farmtrade.pl
Firma FarmTrade jest generalnym przedstawicielem i importerem w Polsce następujących maszyn: Sigma 4 - ładowacze
czołowe; Bargam, ProJet oraz Rimeco – opryskiwacze; Matermacc - siewniki precyzyjne oraz zbożowe; Gallignani - prasy
i owijarki; Sip- maszyny zielonkowe kosiarki, przetrząsarki,zgrabiarki oraz rozrzutniki obornika; Tume- agregaty uprawowo –
siewne; Jean de Bru - brony talerzowe, wały; Goizin - pługi
Stoisko: A 267
Czeska spółka FARMET a.s. jest uznanym partnerem rolników
w dziedzinie uprawy gleby i siewu: agregaty do przygotowania
gleby przed siewem,pługi talerzowe, kultywatory ścierniskowe, siewniki pneumatyczne, głębosze, wały uprawowe oraz
przemysłu przetwórczego:obróbka nasion roślin oleistych,
zwłaszcza rzepaku. www.farmet.pl.
Farmet a. s. is a Czech company, which produces agricultural machinery for breaking and preparation of soil (presowing combinators, share sowing machines, disc plough-harrow, deep cultivators, rollers); extruders, technological units
to process oilseeds and vegetable oils. Company ownes
Certificate EN ISO 9001:2009 www.farmet.cz.
Stoisko: F 303
42
Farmtrac Tractors Europe Sp. z o.o.
11-700 Mrągowo, ul. Przemysłowa 11
tel.: +48 89 743 37 00
fax: +48 89 743 37 01
e-mail: [email protected]
www.farmtrac.pl
ZRP Farmutil HS S.A. Śmiłowo
ul. Przemysłowa 4
64-810 Kaczory
tel./fax: +48 67 28 14 302
e-mail: [email protected]
www.farmutil.pl
Zajmujemy się odbiorem i unieszkodliwianiem ubocznych
produktów pochodzenia zwierzęcego oraz sztuk padłych zwierząt
gospodarskich. Jesteśmy firmą z 30-letnim doświadczeniem w
branży. Zaufały nam już setki klientów. Współpracujemy z firmami o
niekwestionowanej pozycji na rynku. Zapraszamy do współpracy!
We are taking care of collecting and processing animal
byproducts and fallen farm animals. We are a company
with 30 years of experience in this business. Hundreds of
customers have trusted us already. We cooperate with many
F
other market leading companies. We would like to invite you
to cooperation with us!
Stoisko: F 473
Fermo
Piotrów 18
62-814 Blizanów
tel.: +48 62 596 90 00, 596 90 01
fax: +48 62 599 42 30
e-mail: [email protected]
www.fermo.pl
Feerum S.A.
ul. Okrzei 6
59-225 Chojnów
tel./fax: +48 76 818 84 85, 76 819 67 38
e-mail: [email protected]
www.feerum.pl
Feerum SA jest jednym z największych w Polsce producentów
kompleksowych elewatorów zbożowych, służących do suszenia
i magazynowania produktów roślinnych. Spółka oferuje w pełni
kompleksowe rozwiązania – od analizy potrzeb klienta, poprzez
propozycję rozwiązań technologicznych, produkcję urządzeń, aż
po uruchomienie obiektu i oddanie go do eksploatacji, oraz usługi
posprzedażowe, serwis i dostarczanie komponentów do urządzeń. Główne produkty to suszarnie i silosy wraz z oprzyrządowaniem (m.in. rozwiązania do transportu pionowego i poziomego,
czyszczalnie oraz mieszalnie pasz). W maju tego roku Spółka
Feerum z sukcesem zadebiutowała na warszawskiej GPW.
Ferrum SA is one of the largest manufacturers in Poland of
comprehensive grain elevators, used for drying and storage
of plant products. The company offers a fully comprehensive
solutions – from analysis of client’s needs, by proposing of
technical solutions, device production, until start-up of facility
and putting it into operation, as well as after-sales service, service and supply of devices components. The main products
are drying and silos including accessories (among others:
vertical and horizontal transport solutions, cleaning facilities
and fodder mixing). Feerum Company successfully debuted
on the Warsaw Stock Exchange, this year, in May.
Stoisko: C 410
PPUH Feliks Naglak
ul. Borecka 33a
63-720 Koźmin Wlkp.
tel./fax: +48 62 721 68 64
kom.: +48 667 624 525
czyli +48 667 NAGLAK
e-mail: [email protected]
www.naglak.pl
Produkujemy kabiny do ciągników rolniczych oraz kabiny do
kombajnów zbożowych różnych typów: BIZON Z-056, Z-058,
JOHN DEERE, CLASS IPT. Wykonujemy także dachy do
ciągników URSUS C-385, 914, 1012 oraz kabiny i dachy do
wszelkich innych ciągników i kombajnów
We produce cabins for tractors and cabins for varius types of harvesters, for example: BIZON Z-O56, Z-058, CLAAS, JOHN DEERE
ETC. We also produce roofs for tractor's cabins URSUS C-386,
912, 1012 and cabins roofs for other tractors and harvesters.
Stoisko: F 260
Fermo najwyższa jakość hodowli. Firma FERMO zajmuje się produkcją i dystrybucją urządzeń hodowlanych oraz wyposażeniem
ferm i hodowli zwierząt. W ofercie firmy znaleźć można kilka
tysięcy produktów, miedzy innymi poidła, karmidła, systemy pojenia i karmienia, ogrodzenia elektryczne i sprzęt zootechniczny.
Jako producent wysokiej jakości systemów pojenia i zadawania
paszy zaprasza do współpracy fermy, hurtownie i sklepy.
Fermo highest quality breeding. FERMO Company is a manufacturer and distributor equipment for breeding farms and
livestock. The company is offering thousands of products:
drinkers, feeders, watering and feeding systems, electric
fencing and livestock equipment. As a manufacturer of high
quality systems, watering and feeding invites to cooperation
European farms, wholesale and retail stores.
Stoisko: D 432
Firma Nowak Sp.J.
Gościeszyn 3/1
64-200 Wolsztyn
tel.: +48 68 346 90 86
fax: +48 68 322 59 32
Firma Nowak Sp. J. to wiodący i uznany na polskim jaki i
europejskim rynku importer/ eksporter żywca. Podstawą
Naszej działalności jest: - import warchlaków duńskich, holenderskich i niemieckich; skup tuczników i bydła na rzeźnie;
sprzedaż cielaków; skup/ sprzedaż tuczników z importu. Nasza Firma to również transport, oferujemy usługi na zlecenie
firm krajowych i zagranicznych. W swojej flocie posiadamy
trzy, cztero i pięciopoziomowe zestawy do przewozu żywca.
The Nowak Sp. J. Company is a prominent and well-known livestock importer/exporter on the Polish and European market.
The principles of our activity are: importof the Dutch, Danish
and German piglets; buying of sloughter pigs and cattle for
sloughter houses; trading with calves; trading with imported
sloughter pigs. Our copmany offers transport for service as
well. We have 3-, 4- and 5-leveled trucks for livestock.
Stoisko: C 536
Firma Produkcyjno-Usługowo-Handlowa
Michał Michalak
Szarbia Zwierzyniecka 2a
28-530 Skalbmierz
tel.: +48 501 743 994
fax: +48 41 352 96 43
e-mail: [email protected]
www.michalak.co
Stoisko: B 31
43
Spis wystawców
List of exhibitors
Od ponad 30 lat Firma Fliegl jest międzynarodowym liderem
jako producent rolniczych maszyn transportowych. Przyczepa wielofunkcyjna ASW GIGANT z systemem zsuwania
rozwiązała problem transportu, przeładunku i rozrzucania
materiału. W ofercie także tradycyjne przyczepy dwu- i trzyosiowe, przyczepy skorupowe, wozy asenizacyjne, wozy
przeładowcze a także jednoosiowe rozrzutniki obornika.
PPHU Grzegorz Rozalczyk
Parkowo 80A
64-608 Parkowo
tel./fax: +48 67 261 08 86
e-mail: [email protected]
www.mieszalniarozalczyk.pl
Producent środków żywienia zwierząt, mieszanek paszowych
pełnoporcjowych i uzupełniających dla zwierząt gospodarskich. Dystrybutor nawozów wieloskładnikowych, azotowych.
A producer of animal nutrition products, fodder mixtures
for complete and supplementary feeding of farm animals. A
distributor of nitrogen multicompound fertilizers.
For over 30 years Fliegl Company is a global leader as a
manufacturer of agricultural transport units. ASW Giant
multipurpose trailer with push-off system solved the
problem of transport, handling and spreading the material in one combined machine. The company also offers
traditional trailers with two and three axles, dumper trailers,
liquid manure tankers, grain transfer trailers and single-axle
manure spreaders.
Stoisko: D 220
Stoisko: B 345
Firma Usługowo - Handlowa
Dariusz Wichtowski
ul. Daleka 4
60-124 Poznań
tel./fax: +48 61 865 35 21
kom.: +48 601 57 31 98, 601 18 66 28
Stoisko: F 462
DIESEL NA GAZ Firma WW
ul. Wschodnia 4a
99-210 Uniejów
tel.: +48 601 872 723
www.diesel-gaz.eu
W ciągu 20-letniej praktyki w montażu instalacji, 7 lat montuję
własne instalacje gazowe do diesla i podaję gaz do D 50%
Aby zrozumieć sens i logikę montażu i regulacji zapraszam
na szkolenie. Poszukuję montażystów systemu prosty i łatwy.
Produkuję węże do wózków widłowych.
I have 20 years of experience in installing systems, and for
last 7 years I have been installing own gas systems for diesels
and provide gas to D 50%. If you would like to learn more
about installation and control, I provide a dedicated training.
I am looking for installers of a simple and easy system. I
produce hoses for forklift trucks.
Stoisko: F 460
Fliegl Agrartechnik GmbH
Bürgermeister-Boch-Str. 1
D-84453 Mühldorf
Tel. +49 (0) 86 31 307-0
fax: +49 (0) 86 31 3 07-550
e-mail: [email protected]
www.fliegl.com
Kontakt w Polsce:
Mikołaj Sadowski
tel./fax: +49 8631 307 555
kom.: +48 518 250 314
e-mail: [email protected]
44
Flora Sp. z o.o.
ul. Kopernika 15
46-320 Praszka
tel.: +48 34 359 11 89, 34 359 18 29
fax: wew. 13
e-mail: [email protected]
www.flora-praszka.pl
Firma Flora Sp. z o.o. z powodzeniem istnieje na rynku
rolniczym od 15 marca 1990 roku. Jesteśmy liderem
sprzedaży produktów branżowych w południowej Polsce.
Współpracujemy z największymi i najbardziej szanowanymi
producentami i przedsiębiorstwami w sektorze rolnym.
Specjalizujemy się w sprzedaży: środków ochrony roślin,
nawozów, materiału siewnego, pasz i koncentratów, węgla
oraz skupujemy i kontraktujemy zboża.
Flora Company Ltd. Sp. z o.o. exist to the agriculture market
since 15 march 1990. We are one of the leader sales the agricultural products in south the Polish market. We cooperate with
the largest and most respected producers and corporations in
the agriculture sector. Our offer: plant protection products, fertilizer, seeds, animal nutrients, sales of coal. grain trading.
Stoisko: A 330
Florian Centrum S.A.
ul. Metalowa 11 A
99-300 Kutno
tel.: +48 24 355 14 55 - sekretariat
tel.: +48 24 355 14 63 - 65 - dział sprzedaży
fax: +48 24 355 14 69 - sekretariat
fax: +48 24 355 14 66 - dział sprzedaży
e-mail: [email protected]
e-mail:[email protected]
e-mail:[email protected]
www.floriancentrum.com.pl
Spółka Florian Centrum S.A. rozpoczęła swoja działalność
w 1996 roku. W tym czasie stała się ona znanym producentem blaszanych pokryć dachowych i elewacyjnych na
rynku polskim. Udziałowcami firmy są: ArcelorMittal Poland
S.A., Sobiesław Zasada S.A. oraz Wincenty Zeszuta. Kapitał
F
założycielski spółki wynosi 6, 2 mln zł. Działalność firmy można
określić jako produkcyjno – handlową. Spółka posiada w swojej
ofercie blachodachówki o nazwach handlowych: EUROPA,
KINGA, FLORINA, KLARA oraz blachy trapezowe o profilach 8,
12, 18, 35 i 55 mm a także płyty warstwowe typu SANDWICH:
ściennych ( Ps i Psn) oraz dachowych ( Pd i Pdn ). Dzięki
efektywnej współpracy z grupą ArcelorMittal, charakteryzującej
się wieloletnim doświadczeniem w produkcji blach ocynkowanych oraz ocynkowanych i powlekanych w kręgach, Florian
Centrum S.A. oferuje swoim odbiorcom jeden z najlepszych
towarów dostępnych na rynku polskim. Surowcem do wyrobu
blachodachówek oraz blach trapezowych jest blacha stalowa
walcowana na zimno, ocynkowana i powlekana lakierami w
technologii coil coating, co zapewnia długoletnią wytrzymałość
i odporność na warunki atmosferyczne i uszkodzenia mechaniczne. Oferowane powłoki dostępne są w wersji połysków,
matów gruboziarnistych oraz wprowadzonych pod koniec 2011
roku do sprzedaży bardzo odpornych powłok Granite® HDX z
30 letnim okresem gwarancji. Oferowane powłoki dostępne są
w bardzo szerokiej gamie kolorów. Nowością są blachy z powłoką Magnelis® zapewniającą 10 razy wyższą odporność na
korozję niż stal ocynkowana oraz blachy aluminiowe w pięciu
dostępnych kolorach. Siedziba Spółki mieści się w Kutnie, ale
działalnością objęty jest prawie cały obszar Polski.
Stoisko: D 540
Fog Agrotechnik Poland Spółka
ul. Żmigrodzka 41/49
60-171 Poznań
tel./fax: +48 61 867 89 96, 868 62 66
kom.: +48 606 994 906
e-mail: [email protected]
Produkujemy elementy duńskiego, bezpiecznego dla środowiska
systemu bezpośredniego odprowadzania gnojowicy z chlewni.
Zapewniamy bezpłatne doradztwo i pomoc w projektowaniu.
We produce original Danish direct, environmentally friendly flush
systems for pig slurry. We provide free-of-charge consulting and
assistance in designing and implementing our systems.
Stoisko: F 463
P.P.H.U „FOKUS”
Radosław Fibner, Waldemar Staszak
Pieruszyce 3
63-304 Czermin
tel.: +48 62 74 16 735
kom: +48 606 322 231, 505 060 436
e-mail: [email protected]
www.fokus-kotly.pl
Firma FOKUS produkuje wysokiej jakości kotły na paliwa stałe
(miałowe, z podajnikiem ślimakowym, podajnikiem tłokowym
– szufladowym oraz uniwersalne), które cieszą się dużym
zainteresowaniem i uznaniem wśród klientów. Ofertę naszą
rozszerzyliśmy o osprzęt technicznie dopasowany do różnego
rodzaju ładowaczy czołowych, ładowarek teleskopowych i
mini-ładowarek.
The company FOKUS produces high-quality solid fuel boilers
(fine coal with a screw conveyor or piston – tray conveyor,
and universal), sought after and appreciated by our customers. We extended our range with technical accessories
adjusted to various types of front loaders, telescopic loaders
and mini-loaders.
Stoisko: D 570
Fortis Technology Sp. z o.o. Sp.k
ul. Świerkowa 19
64-320 Niepruszewo
tel.: +48 61 820 94 29
fax: +48 61 823 27 94
e-mail: [email protected]
www.zbiornikidopaliw.pl
Stoisko: D 90
FOSFAN S.A.
ul. Nad Odrą 44/65
71-820 Szczecin
tel.: +48 91 453 83 94
fax: +48 91 453 84 85
e-mail: [email protected], [email protected]
www.fosfan.pl
www.fructus.pl
FOSFAN jest producentem wysokiej jakości wieloskładnikowych nawozów rolniczych i ogrodniczych. Nawozy rolnicze
produkowane przez FOSFAN to: SuproFoski, SUPROFOS
25, Superfosfat. Różnorodność składu oferowanych
nawozów umożliwia właściwe nawożenie wszystkich upraw
polowych. Nawozy ogrodnicze Fructus występują w 3
grupach produktowych jako nawozy granulowane, płynne
oraz krystaliczne.
FOSFAN is a manufacturer of high-quality multicomponent
fertilisers for agricultural and horticultural crops. Agricultural fertilisers produced by FOSFAN include: SuproFoski,
SUPROFOS 25, and Superfosfat. A variety in composition
of provided fertilisers ensures correct fertilising of all field
crops. Horticultural fertilisers Fructus are offered in 3 product
groups, as granulated, liquid and crystalline fertilisers.
Stoisko: A 316
Gdańskie Zakłady Nawozów Fosforowych
„Fosfory” Sp. z o.o. Grupa Puławy
ul. Kujawska 2
80 - 550 Gdańsk
tel.: +48 58 343 82 71, +48 58 343 83 76
fax: +48 58 303 85 55
www.fosfory.pl
Historia Gdańskich Zakładów Nawozów Fosforowych „Fosfory”
sięga początków ubiegłego wieku. Niemiecki koncern Milcha w
45
Spis wystawców
List of exhibitors
1912 roku wybudował, właśnie w Gdańsku, pierwsze instalacje
produkcyjne. Zaczęto wytwarzać m.in. kwas siarkowy, solny
oraz mieszanki superfosfatowe. Nazwa – Gdańskie Zakłady
Nawozów Fosforowych (GZNF) - zaczęła obowiązywać od
1966 roku. GZNF Fosfory zajmują się produkcją znanych nawozów Amofoska oraz Superfosfat Wzbogacony. Jednocześnie,
wykorzystując lokalizację zakładu w obrębie gdańskiego portu
oraz fakt posiadania własnego nabrzeża i magazynów, GZNF
prowadzą również działalność usługowo-spedycyjną w zakresie
przewożonych drogą morską towarów masowych sypkich i
płynnych w eksporcie, imporcie oraz tranzycie. W kwietniu
2011 Zakłady Azotowe „Puławy” S.A. nabyły 98,43 proc.
kapitału zakładowego GZNF Fosfory. Dzięki tej transakcji GZNF
stały się znaczącym podmiotem Grupy kapitałowej PUŁAWY,
dla której dobra marka, zaspokojenie potrzeb i wymagań klientów stanowią główny cel strategiczny. W roku 2012 w Zakład
celebrował jubileusz 100-lecia swojego istnienia.
The history of Gdańskie Zakłady Nawozów Fosforowych
”Fosfory” (Gdańsk Phosphorous Fertilisers Company ”Fosfory”) reaches as far back as the beginning of the previous
century. In 1912, Milch company (Germany) built the first
factory installations right here in Gdańsk. The company started
producing sulphuric and hydrochloric acid and superphosphate
mixes. The name Gdańskie Zakłady Nawozów Fosforowych
(GZNF) was introduced in 1966. GZNF „Fosfory” are producing
famous Amofoska and Superfosfat fertilizers. At the same
time, utilising its location within the Gdańsk port and its own
wharf and warehouses, GZNF offers forwarding services for
export, import and transit of mass freight of loose and liquid
goods. In April 2011 Zakłady Azotowe ”Puławy” S.A. acquired
98,43% of the share capital of GZNF ”Fosfory”. After this
transaction, GZNF became an important company within the
PUŁAWY Capital Group, whose main goal is to build a good
and strong brand and to satisfy the needs and requirements of
its clients. In year 2012 GZNF celebrated its 100th anniversary.
Stoisko: A 315
FRANCUSKIE KONSORCJUM TECHNIKI
PRZETWÓRSTWA ROLNO - SPOŻYWCZEGO Sp. z o.o.
ul. Wyczółki 101A
02-823 Warszawa
tel./fax: +48 22 847 21 68, 816 64 24
kom.: +48 602 290 661
e-mail: [email protected]
Konsorcjum FRACOP grupuje 7 francuskich producentów,
wyspecjalizowanych w technologii przechowalnictwa zbóż.
Oferowane urządzenia: Silosy, Suszarnie, Wialnie, Sortowniki,
Przenośniki, Pomiar temperatur, Pobierania probek ziarna,
Wagi i Tłocznie oleju.
FRACOP is a consortium grouping 7 French grain equipment Manufacturers. European leaders in their specialities.
Equipments offered: grain Silos, Silo thermometry, Dryers,
Cleaners-graders, Handling equipment, Weighing units,
automatic grain Samplers and oil seeds Press.
Stoisko: E 298
46
Frisomat Sp. z o.o.
Al. Krakowska 80 a Stefanowo
05-552 Wólka Kosowska
tel.: +48 22 736 29 00-03
fax: +48 22 757 95 05
e-mail: [email protected]
www.frisomat.pl
Frisomat jest znanym na całym producentem budynków
stalowych. Jako profesjonalna firma, działająca na całym
świecie już ponad 30 lat zapewniamy Klientom niezawodne
i atrakcyjne wizualnie hale, wykorzystywane jako magazyny,
chlewnie, kurniki, przechowalnie, chłodnie itp. Lista zadowolonych Klientów świadczy najlepiej o wysokim poziomie
świadczonych przez nas usług. Nasze hale zadowolą trwale.
Frisomat is a worldwide known manufacturer of steel buildings. As a professional company, operating over the world
for over 30 years we provide customers with reliable and
attractive halls, used as industrial buildings, workshops, warehouses, temporary hangars, agricultural hangars, aircraft
hangars, riding arenas, sport halls etc. The list of satisfied
customers proves the high level of services we provide. Our
buildings provide permanent satisfaction.
Stoisko: C 533
FUCHS OIL CORPORATION (PL) Sp. z o.o.
ul. Kujawska 102
44-101 Gliwice
tel.: +48 32 40 12 200
fax: +48 32 40 12 255
e-mail: [email protected]
www.fuchs-oil.pl
Fuchs Oil Corporation (PL) od 1989r. ściśle współpracuje
z przedsiębiorstwami niemal wszystkich branż gospodarki,
w tym również z rolnictwem. Oferujemy środki olejowo-smarne i usługi szkoleniowo-serwisowe w zakresie
prawidłowego i ekonomicznego zastosowania produktów. Troska o jakość znajduje swoje odzwierciedlenie w
Zintegrowanym Systemie Zarządzania serii ISO 9001:2000
i 14001:2004.
Fuchs Oil Corporation (PL) since 1989 closely cooperates
with companies of all economy branches within agriculture.
We offer lubricants and professional training and service in the
field of proper and economic application of Fuchs products.
The care for the quality has its reflection in the Integrated
Management System according to ISO 9001:2000 and
14001: 2004.
Stoisko: C 41
Galeria Ksen Sp. z o.o.
G
ul. Lechicka 59/215
61-695 Poznań
tel.: +48 796 002 003
e-mail: [email protected]
www.galeria-ogrodzen.pl
Stoisko: D 556
P.H.U. GAMA Szepietowscy sp.j.
ul. Przemysłowa 5
18-200 Wysokie Mazowieckie
tel./fax: +48 86 275 36 66, 86 477 10 40
Firma GAMA z Wysokiego Mazowieckiego (woj. podlaskie) oferuje maszyny rolnicze oraz produkty i usługi dla gospodarstw
ukierunkowanych na wydajną produkcję mleka: wozy paszowe
EUROMILK RINO, owijarki samozaładowcze EUROMILK SCORPIO z przednim załadunkiem, stacje paszowe EUROMILK i
roboty paszowe EUROMILK FEEDEX, hale udojowe EUROMILK,
dojarki rurociągowe EUROMILK, świetliki dachowe, okna przesuwne, 24-godzinny serwis maszyn i urządzeń udojowych.
The company GAMA from Wysokie Mazowieckie (Poland)
offers agricultural machinery and products and services for
dairy farms: mixer wagons EUROMILK RINO, self-loading bale
wrapper SCORPIO, feeding stations and feed robot FEEDEX,
Milking parlours EUROMILK, pipeline milking machines
EUROMILK, barn skylight, sliding Windows, 24-hour service
machines and milking equipment.
Stoisko: F 483
GEM-EKO
Białachówko 2A, 83-210 Zblewo
tel.: +48 731 131 101
www.gem-eko.pl
Firma GEM-EKO istnieje na rynku od kilku lat. Jesteśmy w
100% polskim producentem mającym siedzibę na Pomorzu
niedaleko Starogardu Gdańskiego. Działamy na dwóch
rynkach: urządzeń przetwarzania biomasy (brykieciarki,
peleciarki, rozdrabniacze, zbiorniki i inne) urządzeń do
przetwarzania odpadów komunalnych i surowców wtórnych
(prasy, prasokontenery, belownice, sortownie i inne).
Wszystkie urządzenia posiadają certyfikaty CE i deklaracje
zgodności z prawem UE. Na wszystkie urządzenia udzielamy
gwarancji oraz zapewniamy serwis części zamiennych i
serwis pogwarancyjny.
Stoisko: F 458
Geneu Beata Jerczyńska
ul. Powstańców Wielkopolskich 14 A
86-061 Brzoza
tel.: +48 52 381 02 77
fax: +48 52 381 02 78
e-mail: [email protected]
www.geneu.pl
Stoisko: F 491
GEO di BOERI GIOVANNA
Strada Stazione 75
14025 Montechiaro D’Asti
Włochy
tel.: +39 0141 999322
fax: +39 0141 990508
e-mail: [email protected]
www.geo-agric.com
Stoisko: A 2
GASPOL S.A.
Al. Jana Pawla II 80
00-175 Warszawa
tel.: +48 22 530 00 00
fax: +48 22 530 00 01
Bezpłatna Infolinia: 0800 190 190
www.gaspol.pl
GASPOL S.A. to największy dostawca gazu płynnego w
Polsce – uniwersalnego źródła energii dla domu, rolnictwa i
przemysłu Oferuje: gaz w zbiornikach, gaz w butlach, autogaz.
Gaspol zapewnia kompleksową obsługę w zakresie wykonania
instalacji zbiornikowych na gaz płynny: od wykonania projektu, zdobycia niezbędnych uzgodnień, przywiezienia zbiornika,
aż po dostawy gazu.
GASPOL S.A. – is the biggest supplier of Liquefied Petroleum
Gas in Poland – universal source of energy for households,
agriculture and industry. Offers three kinds of products: gas in
tanks, gas in cylinders, autogas. Gaspol provides comprehensive range of services connected with preparation of the bulk
installations for lpg: preparation of the project, getting of all
necessary permissions, tank fixing and gas deliveries.
Gerpol Sp. z o.o.
ul. Braci Kobylańskich 41
26-340 Drzewica
tel./fax: +48 375 51 66
e-mail: [email protected]
www.gerpol.agro.pl
Gerpol Sp. z o.o. to powstała w 2009 r. Spółka
produkująca noże, listwy i narzędzia do maszyn rolniczych. Pomimo krótkiej historii posiadamy wieloletnie
doświadczenie w produkcji asortymentu tnącego do
maszyn rolniczych, bowiem Spółkę zawiązano na bazie
wydziału noży żniwnych GERLACH S.A., przejmując
nie tylko maszyny, urządzenia oraz know-how ale także
doświadczoną załogę.
Gerpol Sp. z o.o. – main manufacturer of blades and knives
for agricultural mowers and harvesters.
Stoisko: F 142
Stoisko: D 415
47
Spis wystawców
List of exhibitors
Geyer & Hosaja Sp. z o.o.
Partynia 12; 39-310 Radomyœl Wielki
tel.: +48 14 680 67 00
fax: +48 14 680 67 07-08
www.geyer-hosaja.com
www.dobroagro.pl
Gospodarz.pl Twój Portal Rolniczy
tel.: +48 68 422 11 63
kom.: +48 506 650 670
e-mail: [email protected]
www.Gospodarz.pl
Firma GEYER & HOSAJA to lider rynku polskiego w zakresie
bieżnikowania opon do samochodów ciężarowych i maszyn
budowlanych. Posiadamy dwa zakłady bieżnikowania opon:
Mielec i Warka, produkujemy szeroki asortyment opon
bieżnikowanych w technologii „na zimno” i „na gorąco”. Dla
branży rolniczej produkujemy opony regenerowane marki
FARMER, rozmiary 385/65R22.5 (15R22.5) i 385/55R22.5
do zastosowań w przyczepach rolniczych i wozach
asenizacyjnych. Oferujemy także dostawy kół kompletnych
z w/w oponami. Zapraszamy do współpracy. Kontakt w
sprawie opon i kół: Mielec - tel.: +48 17 78 00 641, e-mail:
[email protected], Warka – tel.: +48 14 68
03 400, e-mail: [email protected]
Stoisko: F 476
P.H.P.U. GIZEX Sp. z o.o.
Korzkwy 30B
63-300 Pleszew
tel.: +48 62 742 32 34
fax: +48 62 742 22 71
e-mail: [email protected]
www.gizex.com.pl
Stoisko: C 76
Górnicze Zakłady Dolomitowe S.A.
ul. Bacholińska 11
42-470 Siewierz
tel.: +48 32 674 43 00
fax: +48 32 674 43 05
e-mail: [email protected]
www.gzd.com.pl
Producent: nawozów wapniowo-magnezowych węglanowychdla rolnictwa i ogrodnictwa, kamienia dolomitowego- dla
przemysłu hutniczego i chemicznego, kruszyw, mieszanek i
grysów - dla drogownictwa i budownictwa.
Kotły c.o. opalane pelletem, ekogroszkiem, słomą, trocinami,
zrębkami. Wykorzystujemy nietypową biomasę do celów
grzewczych. Posiadamy generatory ciepłego powietrza do
suszarń. Oferujemy szeroki zakres mocy. Realizujemy inwestycje na terenie kraju i za granicą.
Central heating boilers fired with pellet, eco-pea, straw,
sawdust, wood chips. We use atypical biomass for heating
purposes. We have hot air generators for dryers. We offer
wide range of power. We make investments across the
country and abroad.
Stoisko: E 590
Główny Inspektorat Pracy
w Warszawie
ul. Krucza 38/42
00-926 Warszawa
tel.: +48 22 420 37 20
www.pip.gov.pl
Państwowa Inspekcja Pracy - organ kontroli i nadzoru nad
warunkami pracy, w zakresie bhp w rolnictwie prowadzi
działalność prewencyjną: poradnictwo i szkolenia dla rolników
indywidualnych, konkursy dla dzieci i młodzieży, wizytacje
gospodarstw rolnych, publikuje bezpłatne wydawnictwa o
bezpieczeństwie pracy.
Stoisko: C 397
48
Portal o zasięgu ogólnopolskim skierowany do gospodarzy
i firm z nimi współpracujących, grup producentów rolnych,
instytucji rządowych, kadry naukowej oraz studentów.
Dostępny jest też kanał rolniczej telewizji internetowej www.
Gospodarz.tv.
The producer of: calcium and magnesium carbonate fertilizers – for agriculture and gardening, dolomite stone – for
metallurgy and chemical industry, aggregates, mixtures and
grits – for road building and general building industry.
Stoisko: hala 12
Granit Parts Części Zamienne Sp. z o.o. Sp.k.
Sady, ul. Rolna 8
62-080 Tarnowo Podgórne
tel.: +48 61 896 74 80
fax: +48 61 896 74 90
Firma "Granit" to jeden z największych europejskich
dostawców części zamiennych do zachodnich ciągników i
maszyn rolniczych. Posiadamy w ciągłej sprzedaży ponad
140 tyś. pozycji części zamiennych, które dostępne są w
12 katalogach. Razem z częściami oryginalnymi posiadamy
asortyment ponad 5 mln. różnych części. Dystrybucja
towarów odbywa się poprzez sieć dealerów na terenie
całego kraju.
"Granit" company is one of the largest suppliers of spare
parts in Europe to tractors and agricultural machines. We are
constantly selling over 140 thousand items of the spare parts
that are available in 12 catalogues. Together with the original
G
parts we have a range of over 5 million different parts. Distribution of goods takes place through a network of dealers.
Stoisko: C 43
GRANO SYSTEM Ilona Kuleta
Jabłonna 35
97-570 Przedbórz
tel.: +48 792 740 409
fax: +48 44 781 20 68
e-mail: [email protected]
www.grano-system.pl
Stoisko: B 21
Firma Nasienna Granum sp.j.
Wodzierady 81
98-105 Wodzierady
tel.: +48 43 677 31 26, 43 677 35 20
fax: +48 43 675 99 53
e-mail: [email protected]
www.granumfn.pl
Greenland Technologia EM Sp. z o.o.
Trzcianki 6
24-123 Janowiec
tel.: +48 81 888 53 25
fax: +48 81 888 53 26
e-mail: [email protected]
www.emgreen.pl
Polsko - Japońska firma założona w 2000 r. w Puławach.
Oficjalny przedstawiciel Fundacji EMRO z Japonii, wyłączny
producent i dystrybutor preparatów Technologii Efektywne Mikroorganizmy w Polsce. Firma posiada atesty PZH, certyfikaty
zgodności i świadectwa kwalifikacji produktów.
Stoisko: hala 10
GRASDORF KOŁA POLSKA Sp. z o.o.
ul. Kamienna 9
47-300 Krapkowice
tel.: +48 77 46 65 348
e-mail: [email protected]
www.kolagrasdorf.pl
A Polish - Japanese company established in year 2000
in Puławy. An official representative of Japanese EMRO
Foundation, sole manufacturer and distributor of Effective
Microorganisms Technology preparations. EM products has
Polish Hygiene Institute attestations, veterinary and ecology
agriculture certificates.
Stoisko: A 329
Wysokiej jakości felgi i opony do pojazdów pracujących
w rolnictwie, leśnictwie i budownictwie. Koła bliźniacze do
ciągników, kombajnów, pojazdów typu atv, off-road, quad
i innych. Koła do upraw międzyrzędowych. Koła specjalne,
dostosowane do indywidualnych potrzeb. Mobilny serwis
ogumienia, profesjonalne doradztwo.
High quality rims and tires for agriculture, forestry, architecture. Dual wheels for tractors, harvesters, atv’s, quads,
off-road vehicles and others. Wheels for interrow cultivation.
Special wheels made for individual needs. Mobile tire reparation and replacement. Professional consulting.
Stoisko: E 124
Dystrybucja w Polsce: GreenOK.pl
ul. Wrzosowa 16
45-469 Opole
tel.: +48 77 550 62 07
GreenOK - zajmuje się produkcją biologicznie aktywnych oraz
przyjaznych dla środowiska naturalnych nawozów humusowych i stymulatorów wzrostu, zawierających mikroorganizmy
pozyskane z torfu. Firma powstała w 2009 roku na Łotwie.
Sieć dystrybucji produktów obejmuje Polskę, Łotwę, Estonię,
Litwę, Wielką Brytanię i Ghanę. GreenOK Poland dystrybuuje
dwie marki: GreenOK oraz Brunatne BioZłoto. Firma posiada
w asortymencie ponad 20 produktów do pielęgnacji roślin w
każdym stadium rozwoju.
Stoisko: A 322
POLAND
GRASO
Krąg 4A
83-200 Starogard Gdański
tel.: +48 58 562 56 61
fax: +48 58 562 56 69
e-mail:[email protected]
www.graso.eu
Gregoire-Besson Polska Sp. z o.o.
Kowanówko
ul. Obornicka 1A
64-600 Oborniki Wlkp.
tel.: +48 61 297 75 30
fax: +48 61 297 22 62
e-mail: [email protected]
www.gregoire-besson.com
Kotły wodne, nagrzewnice powietrza, przedpaleniska opalane
słomą, biopaliwami i węglem. Producent z kilkunastoletnim
doświadczeniem.
Water heatewr, air heater, dutch ovens Straw, biofuel and coal
fired. Manufacturer with over a decade of experience.
Stoisko: D 562
Stoisko: E 295
Grimme Landmaschinenfabrik GmbH & Co. KG
Hunteburgerstraße 32
D49401 Damme
Niemcy
49
Spis wystawców
List of exhibitors
TRZAK 27,5% azotu (N), 3,5% wapnia (CaO), 4% magnezu
(MgO), KĘDZIERZYŃSKĄ SALETRĘ AMONOWĄ 32% azotu
(N), MOCZNIK GRANULOWANY 46% 46% azotu (N).
tel.: +49 5491 6660
fax: +49 5491 666298
e-mail: [email protected]
www.grimme.de
Stoisko: C 279
Grupa Azoty S.A.
ul. E. Kwiatkowskiego 8
33-101 Tarnów
tel.: +48 14 637 37 37
fax: +48 14 637 33 33
Sprzedaż nawozów:/Sales Department:
tel.: +48 14 637-47-56
faks: +48 14 637-49-39
www.grupaazoty.com
www.nawozy.eu
www.agrolicznik.pl
www.fertilisers.eu
Stoisko: A315, A327
Grupa Azoty Zakłady Azotowe „Puławy” S.A.
Al. Tysiąclecia Państwa Polskiego 13
24-110 Puławy
tel.: +48 81 886 34 31
fax: +48 81 565 28 56
e-mail: [email protected]
www.pulawy.com
Grupa Azoty S.A. jest uznanym producentem nawozów
azotowych granulowanych. Firma jest członkiem Grupy Azoty
posiadającej najszerszą ofertę nawozów azotowych na rynku
polskim. Oferujemy: Saletrosan® 26 makro, Saletrzak 27
standard, Saletrzak z borem 27+B standard, Siarczan amonu
AS 21 makro, selekcjonowany, krystaliczny.
We offer: ASN (Saletrosan® 26 makro), Calcium Ammonium
Nitrate (Saletrzak 27 standard), Calcium Ammonium Nitrate with
boron (Saletrzak z borem 27+B standard), Ammonium Sulphate
(Siarczan amonu AS 21 makro, selekcjonowany, krystaliczny).
Stoisko: A 315
Grupa Azoty
Zakłady Azotowe Kędzierzyn S.A.
ul. Mostowa 30A
skr. poczt. 163
47-220 Kędzierzyn Koźle
tel.: +48 77 481 20 00
fax: +48 77 481 29 99
Biuro Sprzedaży Nawozów:/Sales Department:
tel.: +48 77 481 20 40
fax: +48 77 481 26 27
www.grupaazoty.com
www.nawozy.eu
www.agrolicznik.pl
www.fertilisers.eu
Grupa Azoty Zakłady Azotowe Kędzierzyn S.A. jest uznanym
producentem markowych nawozów azotowych. Firma jest
członkiem Grupy Azoty posiadającej najszerszą ofertę nawozów azotowych na rynku polskim. Oferujemy: SALMAG®
27,5% azotu (N), 3,5% wapnia (CaO), 4% magnezu (MgO),
SALMAG Z BOREM® 27,5% azotu (N), 0,20% boru (B), 3,5%
wapnia (CaO), 4% magnezu (MgO), SALMAG Z SIARKĄ®
27,5% azotu (N), 4,5% siarki (S), 6,5% wapnia (CaO), SALE-
50
We offer: SALMAG® (CAN) 27,5% nitrogen (N), 3,5%
calcium (CaO), 4% magnesium (MgO), SALMAG® with
boron (CAN with boron) 27,5% nitrogen (N), 0,20% boron
(B), 3,5% calcium (CaO), 4% magnesium (MgO), SALMAG®
WITH SULPHUR (AN with sulphur), 27,5% nitrogen (N), 4,5%
sulphur (S), 6,5% calcium (CaO), KĘDZIERZYN AMMONIUM
NITRATE (AN) 32% nitrogen (N), UREA 46% 46% nitrogen (N).
Wiodący w Europie producent jednoskładnikowych nawozów
azotowych: PULAN® - saletra amonowa 34N; RSM® - roztwór
saletrzano-mocznikowy 28N, 30N, 32N; RSM® S - nawóz azotowy z dodatkiem siarki 26N-3S; PULASKA® - nawóz azotowy
z dodatkiem siarki 20N-6S; PULREA® - mocznik nawozowy
46N; PULSAR® - siarczan amonu 20,8N-24,2S. Produkty Efekt
RedNOxTM – to kompleksowa oferta trzech reduktantów, które
umożliwiają skuteczne zastosowanie technologii SCR/SNCR
i redukcje tlenków azotu (NOx): AdBlue® - roztwór mocznika
32,5%; Pulnox® - roztwór mocznika 35%, 40%, 45%; Likam®
- woda amoniakalna 24% oraz chemikaliów: Melaminy - stosuje
się do produkcji klejów w przemyśle płyt drewnopochodnych;
Kaprolaktamu - stosuje się do produkcji poliamidów w przemyśle włókienniczym; H2O2 - nadtlenek wodoru, ekologiczny utleniacz o stężeniu 35%, 49,5%, 50%, 60%; COOLANTTM - suchy
lód (CO2 w formie stałej); gazów technicznych - dwutlenek
węgla CO2, wodór; folii i worków polietylenowych.
Europe's leading manufacturer of straight nitrogen fertilizers:
Pulan ® - 34N ammonium nitrate; RSM ® - 28N, 30N,
32N urea ammonium nitrate solution; RSM ® S - 26N-3S
nitrogen fertilizer with sulfur; PULASKA ® - 20N-6S nitrogen
fertilizer with sulfur; PULREA ® - 46N fertilizer urea; PULSAR
® - 20.8N-24.2S ammonium sulphate. RedNOxTM Effect
Products - a comprehensive offer for three reductants that
enable effective use of SCR/SNCR technologies and reduction
of nitrogen oxides (NOx): AdBlue ® - 32.5% aqueous urea
solution; Pulnox ® - 35%, 40%, 45% aqueous urea solution;
Likam ® - 24% aqueous ammonia solution and chemicals:
Melamine - used for the production of adhesives in wood-based panels industry; Caprolactam - used for the production
of polyamides in textile industry; H2O2 - hydrogen peroxide,
environment-friendly oxidizing agent available with concentrations of 35%, 49.5%, 50%, 60%; COOLANTTM - dry ice
(CO2 in solid form); industrial gases - carbon dioxide, CO2,
hydrogen; polyethylene films and bags.
Stoisko: A 315
G
Grupa Azoty Zakłady Chemiczne „Police” S.A.
ul. Kuźnicka 1, 72-010 Police
tel.: +48 91 317 31 10
fax: +48 91 317 36 03
e-mail: [email protected]
www.polifoska.pl
Grupa Azoty Police proponują rolnikom nowy uniwersalny
nawóz - POLIFOSKA® PLUS. Zawiera on 5% azotu, 10%
przyswajalnego P2O5, 20% K2O, 7% MgO i 9% SO3.
Perfekcyjnie skomponowany skład to podstawa dobrego
ukorzenienia, rozwoju roślin i wysokiej skuteczności. Umiarkowana cena zapewni wysoką efektywność ekonomiczną
nawożenia.
Grupa Azoty Police offer farmers new universal fertilizer POLIFOSKA® PLUS. It contains 5% nitrogen, 10% available
P2O5, 20% K2O, 7% MgO and 9% SO3. Perfectly composed
the composition is the foundation of good rooting, plant
growth and high efficiency. Moderate price ensure high
economic efficiency of fertilization.
Stoisko: A315, E603
GRUPA INCO S.A. z siedzibą w Warszawie
ul. Wspólna 25
00-519 Warszawa
tel.: +48 22 586 51 00
fax: +48 22 586 51 87
e-mail: [email protected]
GRUPA INCO S.A. jest jednym z czołowych polskich producentów nawozów. W ofercie posiada nawozy mineralne i
organiczno-mineralne, przeznaczone do nawożenia wszystkich
rodzajów i gatunków roślin. Od 2012 roku produkuje dolistne
nawozy mikroelementowe oraz wieloskładnikowe pod marką
Florovit AGRO, skierowane na profesjonalny rynek rolniczy.
Produkuje również nawozy przeznaczone na dla hobbystów pod
markami: Azofoska, Florovit, Florovit pro natura oraz Pinivit.
GRUPA INCO S.A. is one of the leading manufacturers of
fertilizers in Poland. The company’s offer includes mineral
and organic-mineral fertilizers for plants of all kinds and
species. In 2012, GRUPA INCO S.A. introduced Florovit AGRO
fertilizers aimed at professional agricultural market. Florovit
AGRO range covers microelement fertilizers and compound
fertilizers for foliar application. GRUPA INCO S.A. is a manufacturer of fertilizers dedicated to hobby sector as well. This
group includes the brands such as Azofoska, Florovit, Florovit
pro natura and Pinivit.
Stoisko: B 338
Grupa Topex Sp. z o.o. Sp. k.
ul. Pograniczna 2/4
02-285 Warszawa
tel.: +48 22 57 30 300
fax: +48 22 57 30 400
e-mail: [email protected]
www.grupatopex.com
Grupa CB Prefabrykacja Sp. z o.o.
ul. Polna 121
87-100 Toruń
tel.: +48 56 612 05 00
fax: +48 56 612 05 01
e-mail: [email protected]
www.rolnictwo.grupacb.pl
Grupa CB jest jednym z największych w Polsce producentów
elementów żelbetowych i betonu towarowego mających
zastosowanie w budownictwie mieszkaniowym, obiektach
przemysłowych, budynkach użyteczności publicznej, w
drogownictwie i w rolnictwie. W ramach działalności rolniczej
oferuje: ruszta betonowe dla trzody i bydła, silosy na kiszonki,
budynki inwentarskie (hodowla zwierząt i magazynowanie
płodów rolnych) wraz z przegrodami i elementami żelbetowymi posadzki oraz generalne wykonawstwo, montaż i
projektowanie.
Grupa Topex posiada kompleksową ofertę narzędzi ręcznych
marek TOPEX i NEO oraz elektronarzędzi i akcesoriów marki
GRAPHITE w różnych segmentach cenowych. W ofercie
ponad 5000 produktów każdy użytkownik narzędzi znajdzie
produkt idealnie dopasowany do jego potrzeb.
Grupa Topex offers a comprehensive range of TOPEX and NEO
hand tools as well as GRAPHITE power tools and accessories
coming in various price segments. The offer includes over
5,000 products so every tool user will find a product perfectly
matching their requirements.
Stoisko: hala 19
Grupa CB is a one of the bigger in Poland producer concrete
precast elements for: multifamily buildings, hall and other
industrial building, road infrastructure and agriculture.
Agriculture area of our activity including: slats panels and
other flooring elements, silos, farm buildings, project and
assembling.
Stoisko: F 467
GUMSTAL Stanisława Lubiszewska
ul. Rybaki 7
85-790 Bydgoszcz
tel.: +48 52 346 82 58
fax: +48 52 346 82 58
e-mail: [email protected]
www.gumstal.pl
Stoisko: C 515
51
Spis wystawców
List of exhibitors
Handlopex S.A. z Rzeszowa posiada 17 filii (Biała Podlaska,
Białystok, Czeladź, Gdańsk, Kielce, Kraków, Lublin, Łódź,
Olsztyn, Poznań, Radom, Rzeszów, Szczecin, Toruń, Warszawa,
Wrocław, Zielona Góra). Zajmuje się hurtową i detaliczną sprzedażą ogumienia (opony do wszelkich typów pojazdów, dętki,
felgi ciężarowe, rolnicze, osobowe – aluminiowe i stalowe).
GXL POLSKA Sp. z o.o.
ul. Środkowa 4
47-400 Racibórz
tel./fax: +48 32 451 67 99
e-mail: [email protected]
Działalność GXL POLSKA od początku istnienia firmy ściśle
związana jest z rolnictwem. Wiodącą branżą naszego przedsiębiorstwa jest hurtowa sprzedaż paliw. Nasza firma specjalizuje się również w sprzedaży zbiorników do magazynowania
produktów występujących w rolnictwie, takich jak: zbiorniki
stalowe na paliwo, silosy na paszę, zboża i materiały sypkie,
zbiorniki elastyczne na RSM, gnojowicę i wodę.
From the very beginning, operations of GXL POLSKA have
been closely related to agriculture. Our leading activities
concern wholesale of fuels. Our company also specialises
in sale of tanks for storage of products and materials found
in agriculture, including: steel fuel tanks, silos for feed, grain
and bulk materials, flexible tanks for UAN, liquid manure and
water.
Stoisko: D 85
Handlopex S.A. from Rzeszów owns 17 branches (Biala
Podlaska, Bialystok, Czeladz, Gdansk, Kielce, Krakow, Lublin,
Lodz, Olsztyn, Poznan, Radom, Rzeszow, Szczecin, Torun,
Warszawa, Wroclaw, Zielona Gora). The company is a wholesaler and a retailer of tyres, tubes and wheel rims – alloy and
steel - (for all types of vehicles like trucks, agricultural and
passenger’s cars).
Stoisko: E 125
Hardi Polska
99-300 Kutno
ul. Sklęczkowska 51
kom.: +48 516 017 632, 509 282 298
www.hardipolska.com
Światowy producent opryskiwaczy zawieszanych, przyczepianych oraz samojezdnych.
The representative office of the World’s leading producer of:
sprayers mounted, trailed and self-propelled.
Stoisko: E 300
HaGe Polska Sp. z o.o.
ul. dr. A. Schmidta 1
86-031 Osielsko
tel.: +48 52 381 36 01
fax: +48 52 381 35 66
www.hagepolska.pl
Kompleksowa oferta HaGe Polska obejmuje najwyższej jakości
produkty z zakresu uprawy roślinnej: materiał siewny, środki
ochrony roślin, nawozy, a także oleje i tworzywa sztuczne. Prowadzimy całoroczny skup zbóż i roślin oleistych. Doradztwo
agrotechniczne HaGe Polska to kompleksowe usługi obejmujące wszystkie aspekty nowoczesnego rolnictwa.
A comprehensive offer of HaGe Polska includes the highest
quality products in the field of farming such as seeds, crop
protection products, fertilizers, oils and plastics. We purchase
grains and oilseeds. Our expertise is a comprehensive service
covering all aspects of modern agriculture.
Stoisko: E 300
HEIN Sp. z o.o.
Miszewo 78
80-297 Banino
tel.: +48 58 685 19 94
kom.: +48 509 107 107
e-mail: [email protected]
www.jd-hein.pl
Jesteśmy Autoryzowanym Dealerem JOHN DEERE. Prowadzimy sprzedaż maszyn komunalnych oraz urządzeń i akcesorii
do pielęgnacji traw na polach golfowych, boiskach czy też
stadionach i rezydencjach. W swej ofercie mamy maszyny
renomowanych firm jak AS MOTOR, WIEDENMANN, MATEV.
We’re authorized dealer of JOHN DEERE. We sell machines
for residentals, general utility and sport and golf fields. In our
offer We have machines famous companies like AS MOTOR,
WIEDENMANN, MATEV and many more.
Stoisko: B 24
Handlopex S.A.
ul. Połonińska 29
35-082 Rzeszów
tel.: +48 17 860 43 32
fax: +48 17 860 43 31
e-mail: [email protected]
www.handlopex.pl
52
Firma „HENRYK” Henryk Batyra
ul. Sierpińskiego 18 A
20-448 Lublin
tel./fax: +48 81 744 41 16
e-mail: [email protected]
Stoisko: F 259
H
Herbert Dammann GmbH
Dorfstraße 17
21614 Buxtehude-Hedenforf
tel.: +49 4143 816 300
e-mail: [email protected]
www.dammann-technik.de
Stoisko: C 280
HERMON
ul. Grzonki 5
47-400 Racibórz
tel.: +48 32 412 0 412
e-mail: [email protected]
www.hermon.com.pl
hydraulic kits, gear and piston pumps, power takes off or
hydraulic cylinders, but trying do develop our assortment
of truck’s bodies components like mudguards or toolboxes
we meet requirements of the market. Matched solutions
in the field of various systems of loading and unloading of
commercial vehicles are supported by long-term experience
which we share with our customers. What is becoming
more and more popular in our country is selective waste
collection. Fulfilling ours customers expectations we have
created skip loader which is winning recognition among our
customers.
Stoisko: hala 16
Stoisko: B 36
www.hewea.com
HEWEA Centrum Techniki Cargo Sp. z o.o.
Byków, ul. Przemysłowa 1
55-095 Mirków k/Wrocławia
tel.: +48 71 345 60 00
fax: +48 71 345 82 13
e-mail: [email protected]
www.hewea.com
Firma HEWEA jest jedną z pierwszych spółek prawa handlowego na Dolnym Śląsku. Ważnym obszarem naszej działalności
jest serwis oraz naprawa hydrauliki siłowej zarówno w czasie
gwarancji jak i w okresie pogwarancyjnym. Dzięki kompleksowej obsłudze, a także wysokiej jakości wykonywanych usług
wpisaliśmy się na trwałe w poczet krajowej branży hydrauliki
siłowej, oferując swoim klientom profesjonalne elementy
hydrauliki siłowej jak pompy tłoczkowe, pompy zębate, zawory
liniowe, rozdzielacze wielosekcyjne, przystawki odbioru mocy
czy siłowniki hydrauliczne. Naszą ofertę uzupełniają elementy
nadwozi takie jak nadkola, skrzynki narzędziowe, kliny, zawiasy
i dźwignie. Trafne rozwiązania na polu różnorodnych systemów
załadunku i rozładunku pojazdów użytkowych są udokumentowane wieloletnim doświadczeniem, którym bardzo chętnie
dzielimy się z naszymi klientami. Efekty naszej pracy były
wielokrotnie nagradzane. W 1992 roku otrzymaliśmy Srebrnego Oskara od Europejskiego Forum Inicjatyw Gospodarczych,
a rok później Srebrną Wstęgę Biznesu przyznawaną przez
Polskie Radio. W roku 1995, jako jedno z pierwszych przedsiębiorstw w branży, uzyskaliśmy uprawnienia Urzędu Dozoru
Technicznego w zakresie montażu żurawi samochodowych.
Od zawsze cenimy jakość, dlatego w naszej ofercie znajdą
Państwo wyroby renomowanych producentów, którzy zajmują
wiodące pozycje na światowych rynkach. Z pewnością wybór
naszego przedsiębiorstwa jako partnera biznesowego umożliwi
realizację planów inwestycyjnych w zakresie sprzętu transportowego, przyczyniając się do rozwoju Państwa firmy.
Hewea company is one of the first commercial companies in
Lower Silesia. From the outset we were focused on commercial vehicles like: aerial platforms, hydraulic cranes, hook
loaders or skip loaders very important part of our business
are services and repairs of power hydraulics during warranty
period and afterwards. Thanks to high quality comprehensive services we are known country-wide. Offering complete
HF Inverter Polska s.c.
ul. M. Skłodowskiej-Curie 101 E
87-100 Toruń
tel.: +48 56 623 73 16
fax: +48 56 623 73 17
e-mail: [email protected]
www.hfinverter.pl
Stoisko: E 589
Grupa HIFI FILTER
18 rue Pierre Dechanet BP 239
F - 25303 PONTARLIER
tel.: +33 (0)3 81 38 86 86
fax: +33 (0)3 81 39 69 14
www.hifi-filter.com
SIŁA GRUPY I ZNAKOMITA OBSŁUGA KIENTA. Grupa HIFI
FILTER jest wiodącym europejskim dostawcą systemów filtracyjnych i części zamiennych do nich. Oferujemy szeroki
zakres wyrobów i usług filtracyjnych w celu zaspokojenia
rosnącego zapotrzebowania naszych klientów. Nasze
rozwiązania w zakresie filtracji obejmują całość zastosowań, a nasz doświadczony zespół sprzedażowy zapewnia
klientom właściwe produkty pozwalające zaspokajać ich
potrzeby biznesowe. Naszym głównym atutem jest 28 000
(największa oferta w Europie) rodzajów wysokiej jakości
filtrów znajdujących zastosowanie w branżach samochodowej i transportowej, rolnictwie, biurach, procesach filtracji
płynów, przemyśle, branży morskiej, przeładunku i robotach publicznych. W SKRÓCIE: najszersza oferta filtrów w
europie, 28 000 rodzajów produktów w magazynach, 23
000 m² powierzchni magazynowej w europie, bezpłatna
ocena potrzeb klienta, tworzenie spersonalizowanego
katalogu dla kompleksu klienta, zarządzanie zapasami na
życzenie klienta.
THE STRENGTH OF A GROUP, WITH EXTRA CUSTOMER
SERVICE. HIFI FILTER Group is the European leading supplier
of filtration systems and replacement parts. We supply a
large spectrum of filtration products and services to meet
the evolving needs of our customers. Our filtration solutions
span the entire life cycle of a customer’s application and
our experienced sales staff provide you the right product
meeting your business needs. Our main strength remains on
our wide range of 28.000 types (the largest filters range in
Europe) of high quality level filters covering needs for several
53
Spis wystawców
List of exhibitors
applications as: automotive, transport, farming / agriculture,
open spaces, fluid filtration, industry, marine, handling &
public works. IN SHORT: The largest filters range in Europe,
28000 stocked references, 23 000 m² storage in Europe,
Free assessment of customers’ needs, Carrying out of a
personalized catalogue of their park, Management of their
stock on request.
varieties in following species: winter and spring oilseed rape,
winter and spring wheat, winter and spring triticale, spring
barley, oats, field bean, peas, soya, flax and poppies. Certified
seed of our varieties are available in good seed companies in
Poland and directly in Hodowla Roślin Strzelce’s affiliates.
Stoisko: B 359
Stoisko: hala 33
HOG SLAT Sp. z o.o.
ul. Za motelem 2 C
62-080 Sady
tel.: +48 61 833 04 55
fax: +48 61 833 00 64
e-mail: [email protected]
www.hogslat.pl
HODOWCA Sp. z o.o.
ul. Starogardzka 70
80-010 Straszyn
tel./fax: +48 58 682 68 56
e-mail: [email protected]
www.hodowca.agro.pl
Kompleksowe wyposażenie budynków inwentarskich, doradztwo, montaż, serwis. Oferta nasza obejmuje m.in. systemy
wentylacji, zadawania paszy, pojenia, ogrzewania, przegród,
kojców, schładzania, oświetlenia.
Comprehensive fitting of buildings animals, consulting,
installation, the service. Our offer includes systems among
other things of ventilation, giving of the fodder, watering, the
heating, partitions, coops, chilling, the lighting system.
Stoisko: F 487
Hodowla Roślin Smolice Sp. z o.o. Grupa IHAR
Smolice 146
63–740 Kobylin
tel.: +48 65 548 24 20
fax: +48 65 548 10 70
e-mail: [email protected]
www.hrsmolice.pl
Stoisko: B 358
Hodowla Roślin Strzelce Sp. z o.o.
Grupa IHAR
ul. Główna 20
99-307 Strzelce
tel.: +48 24 356 69 00
fax: +48 24 356 69 02
e-mail: [email protected]
www.hr-strzelce.pl
54
Firma zajmuje się kompleksowym wyposażeniem ferm trzody
chlewnej i drobiu, w którym zawiera się doradztwo, projekt
technologiczny, dostawa sprzętu, montaż i serwis. Oferujemy
szeroki wybór sprzętu: automaty paszowe, paszociągi spiralne
i łańcuchowo/linowo-krążkowe, poidła, silosy, systemy wentylacyjne, nagrzewnice, kojce, wygrodzenia i inne.
The company sells complete solutions for pig and poultry
farms, including consultancy, projects, delivery of equipment,
installation and service. We offer wide range of products:
feeders, flex augers, chain/cable disc feeding systems, water
cups, silos, ventilation systems, heaters, farrowing crates,
individual stalls and penning systems etc.
Stoisko: E 439
Hohburg Mineralfutter GmbH
Am Lossatal 53
04808 Hohburg (Niemcy)
tel.: 0049-342-637-860
fax: 0049-342-637-86-48
Producent mieszanek paszowych mineralnych, preparatów
mleko zastępczych oraz mieszanek paszowych typu prestarter
i starter dla zwierząt gospodarskich.
A producer of mineral fodder mixtures, milk substitute
specimens as well as pre-starter and starter types of fodder
mixtures for farm animals.
Stoisko: B 345
HODOWLA ROŚLIN STRZELCE Sp. z o.o Grupa IHAR jest
polską firmą hodowlano-nasienną. W ofercie posiadamy ponad
90 odmian w następujących gatunkach: rzepak ozimy i jary,
pszenica ozima i jara, pszenżyto ozime i jare, jęczmień jary,
owies, bobik, soja, groch, len oleisty, mak. Materiał siewny naszych odmian dostępny jest na terenie całego kraju w dobrych
firmach nasiennych oraz bezpośrednio w oddziałach Spółki.
Homburg Machinehandel B.V.
P O Box 5 - 9050 AA STIENS
tel.: +31 58 - 257 15 55
fax: +31 58 - 257 35 35
e-mail: [email protected]
www.draincleaner.nl
Hodowla Roślin Strzelce Sp. z o.o. Grupa IHAR is a Polish
plant breeding company. We have in offer more than 90
Homburg Machinehandel B.V.– Zapraszamy do zapoznania
się z naszą ofertą maszyn do czyszczenia drenaży. Możliwość
sterowania radiowego, oraz zastosowania końcówek GPS
H
do namierzania uszkodzonych elementów. W ofercie również
posiadamy rozwadniacze środków ochrony roślin i płynnych
nawozów Handler z pompami o napędzie hydraulicznym,
elektrycznym lub spalinowym. Wyłączny importer na Polskę:
Polboto-Agri Sp. z o.o.
Stoisko: D 79
Horsch Maschinen GmbH
Sitzenhof 1
D-92421 Schwandorf
tel.: +49 943 171 480
fax: +49 943 141 364
e-mail: [email protected]
www.horsch.com
ofercie firmy na rynku polskim dostępne są na stronie: www.
husqvarna.pl.
Husqvarna® AB –the largest in the world producer of machines for use in forest work and for professional landscape
care, like chain saws, brushcutters, lawn mowers, garden
tractors and riders. Check www.husqvarna.pl for what is
available on the Polish market.
Stoisko: F 242
Stoisko: F 307
Hortmasz Sp. z o.o.
Strobów 2D
96-100 Skierniewice
tel.: +48 46 833 43 56, 46 833 43 62
fax: +48 46 833 25 54
e-mail: [email protected]
www.hortmasz.com.pl
Stoisko: E 231
PPHU Hydramet Sp. z o.o.
ul. Obwodowa 3
11-500 Giżycko
tel.: +48 87 428 61 21
fax: +48 87 429 81 03
www.hydramet.pl
Firma HYDRAMET Sp. z o.o. jest wiodącym, polskim
producentem ładowaczy czołowych, spychaczy czołowych,
pługów odśnieżnych, koparek oraz osprzętu do ładowarek
teleskopowych. Wieloletnie doświadczenie, nowoczesne
technologie oraz certyfikat jakości ISO 9001, pozwalają na
tworzenie produktu o europejskim standardzie.
The company HYDRAMET Sp. z o.o. is a leading Polish producer of front loaders, bulldozers, snowploughs, excavators and
accessories for telescopic loaders. Many years of experience,
modern technologies and a quality certificate for conformance
with ISO 9001 enable us to create products of the European
standard.
HUPRO, spol. s r.o.
Štrková 971/10E,
010 01 Žilina
Robert Grzegorczyk
tel.: +48 793 228 338
Firma Hupro przedstawia wyjątkową i wszechstronną technologię produkcji samonośnych hal. Hale produkowane są na
Słowacji w unikatowej, chronionej patentem technologii, w
systemie 2 w 1, gdzie konstrukcja nośna spełnia jednocześnie funkcję zadaszenia. Budowa przy użyciu tej technologii
gwarantuje znaczną oszczędność kosztów.
Company Hupro introduces a unique and universal technology
of production self-supporting prefabricated halls. Halls are
being manufactured in Slovakia by a unique technology
protected by a patent – system 2 in 1 which the load-bearing
structure fulfills also the function of covering. In case of using
this technology you are being guaranteed significant cost
saving.
Stoisko: D 549
Husqvarna Poland Sp. z o.o.
ul. Wysockiego 15 B
03-371 Warszawa
tel.: +48 22 330 96 00
www.husqvarna.pl
Husqvarna® AB – największy światowy producent urządzeń
mechanicznych, przeznaczonych do prac w leśnictwie
oraz do pielęgnacji terenów zieleni, takich jak m.in. pilarki,
wykaszarki, kosiarki i traktory ogrodowe. Informacje o
Stoisko: A 169
P.P.H. "Hydro-Masz" Sęcerski Sp.J.
Zapole 79/5
98-275 Brzeźnio
tel./fax: +48 43 820 38 95
e-mail: [email protected]
www.hydro-masz.pl
Hydro-Masz jest importerem oraz dystrybutorem generalnym ciągników marki TYM oraz Lindner. Przedsiębiorstwo
zajmuje się również handlem nowymi ciągnikami i maszynami rolniczymi. Prowadzimy profesjonalny serwis ciągników
i maszyn wielu marek, w zakresie gwarancyjnym oraz
pogwarancyjnym. Oferujemy usługi w zakresie zakuwania
węży hydraulicznych oraz produkcji metalowej dla branży
rolniczej i innych.
We act as an importer and general distributor of TYM and
Lindner tractors. We also offer new tractors and agricultural
equipment of other manufacturers. We provide professional
service of agricultural tractors and machines, on both warranty and post-warranty basis. Our services include hydraulic
hose crimping and overall metal production for the agricultural
sector and others.
Stoisko: C 205
55
Spis wystawców
List of exhibitors
HYDROMETAL Tomasz Kowalewski
ul. Lubiejewska 79 (Północna 44 w budowie)
07-300 Ostrów Mazowiecka
kom.: +48 608 043 889, 608 302 904
e-mail: [email protected]
www.hydrometal.pl
Producent ładowaczy czołowych do ciągników rolniczych,
sadowniczych i komunalnych o mocy 40-160 KM oraz
osprzętu do ładowaczy, ładowarek teleskopowych i wózków
widłowych: chwytaki bel, widły do obornika „Krokodyl”, łyżki
do materiałów sypkich, łyżki wielofunkcyjne, widły do palet i
słomy.
Mechanika Urządzeń i Maszyn Rolniczych
IGAMET
Nowe Iganie, ul. Siedlecka 36
08-110 Siedlce
tel./fax: +48 25 632 47 10
e-mail: [email protected]
www.igamet-komorowski.pl
Stoisko: F 256
IMPULS-LEASING Polska Sp. z o.o.
Al. Jerozolimskie 212A
Warszawa
tel.: +48 22 381 00 00
e-mail: [email protected]
www.impuls-leasing.pl
Stoisko: F 243
IMPULS-LEASING Polska Sp. z o.o. należy do grupy bankowej
Raiffeisenlandesbank Górnej Austrii. Dla branży rolniczej, spółka
przygotowała specjalnie dedykowany produkt IMPULS ROLNICZY, w ramach którego finansuje każdy sprzęt rolniczy, a także
samochody osobowe, dostawcze i ciężarowe. Spółka finansuje
do 100% wartości przedmiotów, oferując pożyczkę, pożyczkę z
refinansowaniem z PROW, leasing operacyjny oraz finansowy.
R
Hydropress Wojciech Górzny
ul. Rawska 19B
82-300 Elbląg
tel.: +48 55 235 77 01
tel.: +48 55 236 96 91
fax: +48 55 232 37 98
e-mail: [email protected]
Stoisko: D 83
HYDROPRESS-kompleksowy dostawca komponentów
hydrauliki siłowej od 1997 roku. HYDROPRESS oferuje
najbogatszy wybór asortymentu hydrauliki siłowejw Polsce.
W ofercie naszej znaleźć można doradztwo, projektowanie,dostawy komponentów, jak również montaż i serwis,zarządzane normą ISO 9001. Nasze centrum logistyczne w Elblagu
pozwala na szybką dystrybucję dla każdego i wszędzie.
Wypróbuj nas!
HYDROPRESS provides complete solutions for hydraulic
industry since 1997. HYDROPRESS propose the largest
range of hydraulic assortmentin Poland. We offer components, design, consultation and serviceaccording to the ISO
9001 standards. Our central warehouse in Elblag enables
to have a well organised distribution network, ensuring
prompt outcomes for everyone and every time. Why don't
you try us?
Industra Sp. z o.o.
Ustowo 40h
70-001 Szczecin
tel.: +48 91 482 15 32
e-mail: [email protected]
www.industra.pl
Stoisko: F 148
INDUSTRIEHOF SCHERENBOSTEL
Heinrich Rodenbostel GmbH
Im Winkel 5
30900 Wedemark
Niemcy
tel.: +49 5130 60 72 0
fax: +49 5130 60 72 32
e-mail: [email protected]
www.industriehof.com
Stoisko: F 161
Grupa Kapitałowa Hydrotor S.A.
ul. Chojnicka 72
89-500 Tuchola
tel.: +48 52 336 36 00
fax: +48 52 334 86 35
Stoisko: F 160
HZPC Polska Sp. z o.o.
ul. Bałtycka 6
61-960 Poznań
tel./fax: +48 61 848 38 86
e-mail: [email protected]
Stoisko: B 371
lndustriehof Scherenbostel Heinrich Rodenbostel GmbH z
siedzibą w Wedemark, Niemcy, to jeden z wiodących europejskich dostawców części do maszyn rolniczych i gospodarki
komunalnej. Od ponad 40 lat Ind ustriehof oferuje swoje
wysokiej jakości produkty producentom oraz branżowym
firmom handlowym w całej Europie.
lndustriehof Scherenbostel Heinrich Rodenbostel GmbH,
based in Wedemark, Germany, is one of Europe's leading
distributors of parts for agricultural nnachinery and grounds
care equipment. lndustriehof services dealers and manufacturers Europe wide, exclusively featuring high quality products in
its range for more than 40 years.
Stoisko: C 46
56
I
INDUSTRY Diesel&Oil
ul. Dziadoszańska 10
61-248 Poznań
tel.: +48 61 871 20 00
fax: +48 61 871 20 01
e-mail: [email protected]
www.diesel-oil.pl
Stoisko: D 82
INFOMAX Sp. J.
ul. M. Opielińskiej 21
25-604 Kielce
tel.: +48 41 343 10 50
fax: +48 41 366 23 66
e-mail: [email protected]
www.infomax.pl
www.infomax.com.ru
www.infomax.com.de
Wydawnictwo reklamowe, drukarnia offsetowa & cyfrowa,
producent kalendarzy
Instytut Zootechniki Państwowy Instytut Badawczy
ul. Sarego 2
31-047 Kraków
tel.: +48 12 422 88 52
fax: +48 12 422 80 65
ul. Krakowska 1
32-083 Balice
tel.: +48 12 357 25 00
fax: +48 12 285 67 33
e-mail: [email protected]
www.izoo.krakow.pl
Działalność Instytutu Zootechniki PIB obejmuje prowadzenie
prac badawczych w zakresie nauk zootechnicznych ukierunkowanych na bieżące i perspektywiczne potrzeby produkcji
bezpiecznej żywności w warunkach przyjaznych zwierzętom
i środowisku oraz wykorzystanie zwierząt gospodarskich w
celach biomedycznych.
Stoisko: hala 22
Stoisko: hala 1
ING Usługi Finansowe S.A.
Topiel 12
00-342 Warszawa
tel.: +48 618 599 100
Stoisko: C 529
INOFAMA S.A.
ul. Metalowców 7
88-100 Inowrocław
tel.: +48 52 355 02 60
fax: +48 52 353 38 16
e-mail: [email protected]
www.inofama.com
Stoisko: E 438
Insefarm Sp. z o.o.
ul. Zelgniewska 6
64-810 Kaczory
tel.: +48 67 281 43 70
fax: +48 67 281 73 72
e-mail: [email protected]
www.insefarm.pl
Zajmujemy się produkcją i dystrybucją materiału biologicznego – nasienie knurów. Rasy polskie i zagraniczne.
We are a company taking care of production and distribution
of biological material – boar semen. We offer Polish and
International breeds.
Stoisko: F 473
Inter Cars S.A.
ul. Powsińska 64
02-903 Warszawa
tel.: +48 22 714 17 98
fax: +48 22 714 17 18
e-mail: [email protected]
www.intercars.com.pl, www.warsztat.intercars.com.pl
Inter Cars SA to największy dystrybutor części zamiennych
do samochodów osobowych, dostawczych i ciężarowych
w Europie Środkowo–Wschodniej. W ofercie spółki znajduje
się ponad milion części zamiennych do samochodów osobowych, ciężarowych, części zamiennych i akcesoriów do
naczep, przyczep, autobusów, maszyn rolniczych oraz pełna
oferta narzędzi i wyposażenia warsztatów. Posiadamy 153
filie w kraju (w tym 84 filii ciężarowych) oraz 106 oddziałów
w Europie.
Inter Cars SA is the biggest automotive spare parts distributor
for passenger cars, commercial vehicles and trucks in
Middle-Eastern Europe. The product range of the Company
reaches over one million different automotive spare parts for
passenger cars, trucks, trailers, semitrailers, buses, agricultural machineries, Tools and Garage Equipment. We have 153
branches in Poland and 106 branches in Europe.
Stoisko: C 54
INTER IMPORT-EXPORT Sp. z o.o.
ul. Piaskowa 5
63-940 Bojanowo
tel./fax: 65 545 65 10
e-mail: [email protected]
www.inter-import-export.pl
57
Spis wystawców
List of exhibitors
Wyłączny i autoryzowany przedstawiciel belgijskiej firmy Gebr.
GEENS N.V. producenta maszyn służących do układania kostki
brukowej oraz obsługi zagospodarowań zielonych. Maszyny
świetnie sprawdzają się w branży rolniczej, będąc znakomitym
pomocnikiem w wielu codziennych czynnościach, a przy tym
są wytrzymałe, trwałe i jedyne w swojej klasie.
INVENTOR JOŃSKI JAN
Leśna 20
08-124 Mokobody
tel.: +48 25 641 13 92
fax: +48 25 641 13 40
e-mail: [email protected]
www.inventor-mokobody.pl
Stoisko: B 23
INWEST AGRO Techniczna Obsługa Rolnictwa
Wojciech Sieńko
Tereszyn 25
21-030 Motycz
tel./fax: +48 81 503 22 22
e-mail: [email protected]
www.inwest-agro.pl
Stoisko: F 470
Interhandler Sp. z o.o.
87-100 Toruń
ul. Wapienna 6
tel.: +48 56 610 28 20
fax: +48 56 648 04 00
e-mail: [email protected]
www.interhandler.pl
www.jcb.com.pl
Sprzedaż rolnych maszyn nowych i używanych JCB. Autoryzowany serwis JCB. Sprzedaż oryginalnych części zamiennych JCB. Doradztwo techniczne. JCB machines sales, new
and second-hand. Authorized JCB service. Original JCB spare
parts and maintenance materials. Technical consulting.
Stoisko: C 277
Inter-Lers Sp. z o. o.
ul. Czarnieckiego 8
62-270 Kłecko
tel./fax: +48 61 427 04 23
e-mail: [email protected]
www.inter-lers.pl
Jesteśmy znanym i cenionym producentem prefabrykowanych konstrukcji drewnianych w systemie MiTek. Wysoka
jakość naszych kratownic połączona z fachową obsługą
powoduje, że nasi klienci są zadowoleni z współpracy z nami.
Nasze konstrukcje doskonale sprawdzają się na budynkach
typu chlewnie, kurniki, obory, stodoły, wiaty, stajnie, ujeżdżalnie, hale i domy mieszkalne. Nasz zakład zajmuje się projektowaniem, produkcją, montażem konstrukcji drewnianych.
We are well known and respected manufactturer of prefabricated wooden structures in the system MiTek. High quality of
our trusses combined with professional service makes our
customers are satisfied with cooperation with us. Our designs are ideal for buildings such piggeries, poultry houses,
barns, sheds, stables, riding schools, halls and houses. Our
factory is engaged in designing, manufacturing, assembly of
wooden structures.
Stoisko: D 420
P.P.H.U. Inter-tech Piotr Jankowski
ul. Aleja Wojska Polskiego 100
18-300 Zambrów
tel./fax: +48 86 276 12 87
e-mail: [email protected]
www.intertech-agro.pl
IOW SERVICE Sp. z o.o.
Kochlice, ul. Lubińska 1c
59-222 Miłkowice
tel.: +48 76 852 21 17
fax: +48 76 852 21 19
e-mail: [email protected]
internet: www.iowservice.pl
www.spicer24.com, www.carraro24.com
www.kessler24.com, www.tigraflex.com
www.sklep.rud.pl
IOW SERVICE - Centrum serwisowe oraz dystrybutor
producenta DANA SPICER (autoryzowany, jedyny i wyłączny
przedstawiciel na Polskę) oferuje naprawy gwarancyjne i
pogwarancyjne oraz dostawę oryginalnych części zamiennych do skrzyń biegów, przekładni, zmienników momentu,
mostów napędowych sztywnych oraz skrętnych produkcji
DANA SPICER, CLARK, CLARK-HURTH, SIGE, COMAXLE
stosowanych w ciągnikach rolniczych, podnośnikach
teleskopowych, kombajnach, maszynach leśnych itp. IOW
SERVICE to również to dystrybutor części zamiennych
do skrzyń biegów oraz mostów napędowych producenta
CARRARO, ZF jak również układów napędowych KESSLER
oraz AXLETECH. IOW SERVICE to wyłączny przedstawiciel w
Polsce firmy RUD & ERLAU, oferującej łańcuchy ochronne
oraz antypoślizgowe na koła do ładowarek, koparek, ciągników rolniczych oraz łańcuchy antypoślizgowe na zimę dla
pojazdów osobowych i ciężarowych. W ofercie firmy IOW
SERVICE znajdziemy również produkty renomowanej firmy
TIGRAFLEX - oferującej cięgna, linki push-pull oraz układy
sterowania. Oferujemy: - Profesjonalne naprawy i remonty,
- Oryginalne części zamienne DANA SPICER, CARRARO, ZF,
- Oryginalne filtry i systemy filtracji, - Łańcuchy ochronno-trakcyjne RUD&ERLAU, - Linki, cięgna oraz układy sterowania TIGRAFLEX, - Profesjonalną stację diagnostyczną,
- Możliwość napraw u klienta, - Serwis dostępny na terenie
całego kraju, - Skrzynie biegów oraz mosty napędowe
zastępcze na czas naprawy.
Stoisko: E 123
Stoisko: D 599
58
Stoisko: A 16
I
Przedsiębiorstwo „GĄSKA” to producent i dystrybutor części
zamiennych do zachodnich maszyn rolniczych, oferujemy:
CZĘŚCI DO KOMBAJNÓW ZBOŻOWYCH I PRAS Claas, MF,
John Deere, Deutz, CZĘŚCI SILNIKOWE I CIĄGNIKOWE MF,
Case, Deutz, Fendt, John Deere, Perkins, Renaulti PASY
ROLNICZE; ŁAŃCUCHY. Obsługujemy klientów z całej Polski.
Dostawy ekspresowe w 24 godziny.
IOW TRADE Sp. z o.o.
ul. Zwoleńska 17
04-761 Warszawa
tel.: +48 22 512 56 60
fax +48 22 512 56 69
email: [email protected]
www.iow.pl
www.iow24.com
www.mann-filter.com
„GĄSKA” Company produces and distribute spare parts for agricultural machines for: Combine harvesters and balers Claas, MF,
John Deere, Deutz Fahr, New Holland; Engine and tractor spare
parts MF, Case, David Brown, Deutz, Fendt, New Holland, John
Deere, Landini, Perkins, Renaulti; Agricultural belts; Chains. We
serve clients all over Poland and Europe. Express delivery.
Komponenty do maszyn rolniczych, budowlanych,
górniczych. Filtry: powietrza, kabinowe, oleju, paliwa,
hydrauliczne, kompletne systemy filtracji. Podzespoły
napędowe: przekładnie, mosty, motoreduktory, sprzęgła,
łańcuchy. Hydraulika siłowa: pompy, rozdzielacze, orbitrole, silniki hydrauliczne, chłodnice, układy hamulcowe,
zawory. Doradztwo techniczne i serwis. Przedstawicielstwo firm: MANN&HUMMEL, CASAPPA, DANA SPICER
OFF-HIGHWAY, WALVOIL, IKRON, SAFIM, VARVEL, CENTA,
WIPPERMANN.
Stoisko: F 132
JANSSEN POLAND Sp. z o.o.
Pniewo 52
99-311 Bedlno
tel.: +48 24 282 14 44
fax: +48 24 282 14 44
e-mail: [email protected]
Stoisko: E 229
Stoisko: E 123
JFC Polska Sp. z o.o.
Karpin 1a
05-252 Dąbrówka
tel./fax: +48 29 757 83 77, 29 757 82 01
e-mail: [email protected]
www.jfcpolska.pl
ITALCOM Sp. z o.o.
Al. Roździeńskiego 188 B
40-203 Katowice
tel./fax +48 32 204 35 13
e-mail: [email protected]
www.italcom.com.pl
Wyposażenie serwisów samochodowych osobowych,
ciężarowych i dostawczych w: urządzenia do dystrybucji,
wymiany olejów, smarów i płynów roboczych, podnośniki,
urządzenia do diagnostyki, urządzenia do obsługi ogumienia, urządzenia do obsługi klimatyzacji, meble i narzędzia
warsztatowe, instalacje sprężonego powietrza, instalacje
dystrybucji olejów z monitoringiem, obrabiarki specjalistyczne, urządzenia myjące.
Stoisko: F 167
Izolacja Pluimers Sp. z o.o.
ul. Wojska Polskiego 10A
39-300 Kutno
Stoisko: E 574
Firma JFC Polska Sp. z o.o. oferuje: poidła niezamarzające do
-30°C, podgrzewane, wylewne, maty legowiskowe, wygrodzenia Deluxe, hydrauliczne zgarniacze obornika, czochradła
automatyczne, domki do odchowu cieląt, wanienki do dezynfekcji racic, owijarki Tanco, przesuwne okna wentylacyjne,
świetliki kalenicowe, docieplenia, zbiorniki na gnojówkę,
przydomowe oczyszczalnie i szamba.
JFC Polska Sp. z o.o. offers: Non-freezing drinkers up to
-30°C; Heated drinkers; tip-over drinkers, Lying mats for
cows; Cow cubicle Deluxe; Hydraulic manure scrapers;
Automatic cow brushes; Calf hutches; Baths for cloven hoof
disinfection; Tanco wrappers; Ventilation windows, Ventilation
nets, wind stopping curtains; roof ridge skylights; Building
insulation; Sewer tanks; Wastewater treatment systems.
Stoisko: F 477
J.A. GĄSKA - Jacek Gąska i Aleksander Gąska
Spółka Jawna
Gotkowice 85
32-048 Jerzmanowice
tel.: +48 12 389 09 40, 12 389 09 41
tel.: +48 12 389 09 42
fax: +48 12 389 32 03
e-mail: [email protected]
www.gaska.com.pl
John Deere Polska Sp. z o.o.
ul. Poznańska 1b
62-080 Tarnowo Podgórne
tel.: +48 61 81 15 196
fax: +48 61 81 15 197
e-mail: [email protected]
www.johndeere.pl
Stoisko: B 273
59
Spis wystawców
List of exhibitors
TUPLA 170, applicators for souring agents, wood chippers
– 12 models, cranes and trailers for transport of logs, drum
grain sorting machines.
Josera Polska Sp. z o.o.
Paproć 95
64-300 Nowy Tomyśl
e-mail: [email protected]
tel.: +48 61 44 44 731 do 733
fax: +48 61 44 44 739
www.josera.pl
Stoisko: D 294
Josera jest jednym z największych w Europie producentów
wysokiej jakości mieszanek mineralno–witaminowych i
preparatów mlekozastępczych dla bydła i trzody chlewnej. Jako jedyna firma w Niemczech od 20 lat nie miała
żadnej reklamacji ze strony DLG. Od 1994 roku nie stosuje
antybiotyków.
Josera is market leader for high quality mineral feed in Germany and one of the leading companies in Europe. We produce
mineral feed for animals, milk replacer, hygienic products.
Our products have passed every DLG (German Agricultural
Society) test in the last 19 years without one single complaint.
Josera is the only well known producer to have completely
and successfully abandoned the addition of antibiotic performance enhancers. This policy has been in place since 1994.
Stoisko: B 350
Przedsiębiorstwo Wielobranżowe 'KiJ' s.c.
Jerzy i Lucyna Mulzahn & Krzysztof i Urszula Wolnik
Stopka 7
86-010 Koronowo
tel.: +48 52 382 36 74, 52 382 86 12, 52 382 56 19
fax: +48 52 382 10 38
www.kij.pl
Firma PW KiJ działa w branży rolniczej od 1987r. Produkujemy zamienniki części m.in. do kombajnów GRIMME,
STOLL, ROPA, KLEINE, KVERNELAND, REEKIE, AVR; całe
transportery do załadunku lub sortowania; pasy i przenośniki
z dowolnym podziałem; rolki gumowe, żeliwne, żeliwno-gumowe; wiele innych części.
PW KiJ has been operating in the agricultural industry since
1987. Our production: spare parts for GRIMME, STOLL,
ROPA, KLEINE, KVERNELAND, REEKIE, AVR combine
harvester; complete conveyors for loading or sorting; belts
for conveyors with different types of spacing; rubber and
metal-rubber rolls.
Stoisko: D 95
Joskin Polska Sp. z o. o.
ul. Gorzowska 62
64-980 Trzcianka
tel.: +48 67 216 82 99
fax: +48 67 216 83 22
e-mail: h[email protected]
www.joskin.com
Stoisko: D 289
Junkkari Polska Sp. z o.o.
ul. Grunwaldzka 83
99-300 Kutno
tel./fax: +48 24 254 91 74
kom.: +48 608 436 070, 606 418 519, 600 896 586
e-mail: [email protected]
www.junkkari.pl
Od ponad 50 lat Junkkari produkuje i sprzedaje, dobrze
znane na całym świecie maszyny rolnicze i leśne z Finlandii.
Oferujemy: siewnik zbożowo-nawozowy SIMULTA 3m i
4m, agregaty uprawowo siewne MAESTRO 3 i 4, sieczkarnie wielozadaniowe TUPLA 170, aplikatory do środków
zakiszających, rozdrabniacze do gałęzi 12 modeli, żurawie
i przyczepy do transportu bali drewnianych, sortowniki
bębnowe do ziarna.
Junkkari produces and sells worldwide known Finnish machines for farming and forestry. We offer: grain and fertiliser
sowing machine SIMULTA 3m and 4m, sets for cultivation
and sowing MAESTRO 3 and 4, multi-functional chaff cutters
60
K+S Polska Sp. z o.o.
pl. Wiosny Ludów 2
61-831 Poznań
tel.: +48 61 850 93 66
fax: +48 61 850 93 67
www.ks-polska.com
K+S KALI GmbH to międzynarodowa firma zajmująca się
wydobyciem surowców oraz produkcją nawozów wysokiej
jakości. Naszą specjalnością są produkty zawierające potas,
magnez i siarkę, wyróżniające nas na tle konkurencji i zapewniające nam pozycję światowego lidera w sektorze produkcji
nawozów. Nawozy takie jak: Korn-Kali®, Patentkali®,
EPSO Top®, EPSO Microtop®, KALISOP, ESTA® Kizeryt,
Magnesia-Kainit® od lat stosowane są w gospodarstwach
nastawionych na osiąganie wysokich plonów z zachowaniem
najwyższej jakości plonowania.
K+S Kali GmbH – authority in potassium and magnesium.
Natural fertilisers: Muriate of Potash 60er Kali, Korn-Kali®,
Patentkali, EPSO Top®, EPSO Microtop, KALISOP, ESTA®
Kieserite, Magnesia-Kainit®.
Stoisko: A 312
K
Kabat s.j.
ul. Gumowa 6
64-840 Budzyń
tel.: +48 67 283 41 00
fax: +48 67 283 41 58
e-mail: [email protected]
www.kabat.pl
Karol Sp. z o.o.
Odolion
ul. Szosa Ciechocińska 25
87-700 Aleksandrów Kujawski
tel./fax: +48 54 282 35 84
e-mail: [email protected]
Jesteśmy producentem dętek, ochraniaczy, profili gumowych,
mieszanek gumowych oraz szeroko pojętych technicznych
wyrobów z gumy. Od tego roku rozpoczęliśmy również produkcje i sprzedaż opon rolniczych. Firma powstała w roku 1983
i od początku jest ona biznesem rodzinnym. Właścicielami są
dwaj bracia Andrzej i Tadeusz Kabat. Obecnie eksportujemy
do ponad 60 krajów na całym świecie w Europie, Ameryce,
Azji i Afryce. Roczna sprzedaż dętek kształtuje się na poziomie
5mln szt., a całkowita roczna produkcja to niemal 15 000 ton
wyrobów gumowych. Gwarantujemy dostawę dętek i ochraniaczy w ciągu 48 godzin na terenie kraju. W celu zamówień
lub zapytań indywidualnych prosimy o kontakt na [email protected]
kabat.pl lub telefonicznie 67 28 34 100 (fax 67 28 34 158).
Serdecznie zapraszamy na nasze stoisko.
We manufacture inner tubes, flaps, rubber profiles, rubber
compounds, and various technical rubber products. This year
we have started also the production of agriculture tyres.We
have been on the market since 1983 as a family business.
The co-owners are two brothers, Andrzej and Tadeusz Kabat.
We have been selling to almost 60 countries worldwide in
Europe, America, Asia and Africa. Our annual sales is about
5M pieces of inner tubes, total output being about 15M tons
of finished rubber products. We prepare every quotation individually, based on the required quantity and variety of goods.
For inquiries please contact us at [email protected] or +48 67
2834 100. We look forward to meet you at our stand.
Oferujemy: przenośniki: łańcuchowe (pionowe i poziome),
ślimakowe, kubełkowe, i inne; redlery poziome; ślimaki
pionowe do rozładunku i załadunku silosów; rozrzutniki ziarna
w silosie; mieszadła ziarna w silosie; wentylatory ocynkowane: typ: TLR (do wentylacji ziarna w silosach), typ HLSG (do
suszarni podłogowych), sterowniki do wentylatorów. Ponadto
oferujemy usługi: obróbki metali skrawaniem (toczenie
/270mm * 1000mm/, frezowanie), spawanie.
We offer you: devices to grain transportation: chain conveyors
(horizontal and vertical), wormgear, container and another;
wormgear conveyors; the vertical wormgears to unloading
also to loading of silos; disperser of grain in silo; mixerarm of
grain in silo; ventilators: type: TLR (to aeration and cooling of
gain), type: HLSG (to on floor dryers) controllers to ventilator.
Additionally we offer services: machining of metallic element
(turning /270mm * 1000mm/, milling), welding.
Stoisko: D 427
Kasa Rolniczego Ubezpieczenia Społecznego
Centrala
Aleja Niepodległości 190
00-608 Warszawa
www.krus.gov.pl
Stoisko: C 396
Stoisko: E 129
„KABER” Grzegorz Schienke
ul. IV Dywizji Piechoty 10A
77-420 Lipka
tel.: +48 663 792 692
e-mail: [email protected]
www.obciazniki.com.pl
Stoisko: F 149
Kazgod Sp. z o.o.
ul. Wierzbowa 7, 05-870 Błonie
tel./fax: 22 725 38 93
www.kazgod.pl
www.nawozyfoliq.pl
Kazgod – nowoczesna, polska firma zajmująca się dystrybucją środków ochrony roślin, nawozów, materiału siewnego,
pasz, płodów rolnych oraz produkcją nawozów dolistnych
FoliQ. Istnieje od 1989 roku. Współpracuje z najlepszymi
dostawcami materiałów do produkcji rolnej.
KAGRO Krzysztof Pankowski
PUNKT SPRZEDAŻY MASZYN
ul. Jana Pawła II 31
64-932 Stara Łubianka k/Piły
tel.: +48 67 216 03 18
fax: +48 67 216 03 12
e-mail: [email protected]
www.kagro.pl
Kazgod – Polish agricultural distributor founded in 1989. The
company specializes in agricultural distribution ( cooperating
with the international agricultural companies) and production
of fertilizers containing nanoparticles - FoliQ.
Stoisko: B 188
Stoisko: A 333
61
Spis wystawców
List of exhibitors
tel.: +48 41 366 92 22
fax: +48 41 361 39 99
e-mail: [email protected]
www.kksm.pl
Kellfri Sp. z o.o.
ul. Sklęczkowska 16
99-300 Kutno
tel.: +48 24 722 11 50
kom.: +48 795 570 088
e-mail: [email protected]
www.kellfri.pl
KKSM SA są producentem wysokiej jakości wapna nawozowego zawierającego magnez. Nawozy produkowane są w
Kopalniach: Jaźwica, Laskowa i Winna.
Stoisko: hala 41
Kellfri oferuje na rynku polskim szeroką gamę produktów
dla rolnictwa, leśnictwa i gospodarki komunalnej: maszyny
do zbioru zielonek, osprzęt do ładowaczy czołowych,
przyczepy rolnicze, paśniki dla zwierząt. przyczepy leśne,
urządzenia do pozyskiwania i obróbki drewna. Proponujemy
również pełen zakres maszyn i osprzętu do współpracy z
quadami.
Kellfri, an international company with swedish roots,
offers a wide variety of agricultural, forestry and municipal
products. Polish customer can choose from haymaking
machinery and animal feeders, through trailers and compact
loader equipment to forest trailers and woodworking
machinery. On its offer Kellfri has also ATV machinery and
equipment.
Stoisko: E 235
Kessens - Twój partner w inżynierii rolniczej
Kessens Technik mit System GmbH & Co.KG
ul. Kolejowa 3
59-225 Chojnów
tel./fax: +48 76 871 31 30
kom.: +48 794 748 950
e-mail: [email protected],
[email protected]
www.kessens-technik.com
Oferujemy nowoczesne rozwiązania dla rolnictwa i przemysłu.
Technologie: magazynowania, transportu, rozdrabniania,
mieszania zbóż i innych materałów sypkich. Projektujemy i
wykonujemy budynki inwentarskie według życzenia i potrzeb
klienta. Dysponujemy szerokim asortymentem maszyn
rolniczych.
Kessens is Your reliable partner in the field of agricultural and
industrial technology. We design, build, deliver and set up
plant equipment for the storage, conveying and processing of
bulk materials for both: agriculture and industry.
King Tony Polska
Platynowa 23
62-052 Komorniki
tel./fax: +48 61 810 88 07
e-mail: [email protected]
www.kingtony.com.pl
Stoisko: F 157
Kingspan Environmental Sp. z o.o.
Topolowa 5
62-090 Rokietnica
tel.: +48 61 814 44 00
fax: +48 61 814 54 99
www: www.environmental.kingspan.pl
Kingspan Environmental Sp. z o.o. to firma, która od ponad 30 lat
dostarcza gotowe rozwiązania skierowane dla sektora rolniczego.
W ofercie znajdują się m.in. mobilne i stacjonarne urządzenia do
magazynowania i dystrybucji oleju napędowego (FuelMaster®,
TruckMaster®), AdBlue® (BlueMaster®, Slimline), substancji
chemicznych, nawozów (AgriMaster), oraz innych produktów
skierowanych dla sektora rolniczego np. poidła czy domki
dla cieląt. W ofercie również pojemniki do selektywnej zbiórki
odpadów, pojemniki na substancje sypkie, kompletne systemy
z zakresu zagospodarowania wodą, m.in. przydomowe oczyszczalnie ścieków oraz zbiorniki na wodę pitną czy deszczową.
Kingspan Environmental Sp. z o.o. is one of the leading
companies in its field and has more than 30 years experience
developing and supplying perfect solutions to the agricultural
sector. We offer stationary and mobile tanks for the storage
and distribution of fuel (FuelMaster®, TruckMaster®),
AdBlue® (BlueMaster®, Slimline), chemicals and fertilizers
(AgriMaster). We also offer other products dedicated to the
agricultural sector such as calf hutches and cattle drinkers.
In our offer you will also find waste containers, bulk materials
bins, drinking water tanks as wells as complete solutions for
wastewater treatment and rainwater harvesting.
Stoisko: C 85
Kieleckie Kopalnie Surowców Mineralnych
Spółka Akcyjna w upadłości układowej
ul. Ściegiennego 5
25-033 Kielce
62
Stoisko: D 87
Kingspan Insulation Sp. z o.o.
ul. Gdańska 134
62-200 Gniezno
tel.: +48 61 425 56 48
fax: +48 61 424 73 70
e-mail: [email protected]
www.kingspaninsulation.pl
Stoisko: E 447
K
Klaus-Peter Zander Sp. z o.o.
Paproć 132 A
64-300 Nowy Tomyśl
tel.: +48 61 442 11 89
fax: +48 61 442 11 90
kom.: +48 691 303 602
e-mail: [email protected]
www.kpzwagi.pl
Stoisko: E 602
KLIM'TOP CONTROLS Polska Sp. z o.o.
Suchlica 29
74-404 Cychry
tel./fax: +48 95 752 36 18
www.klimtop.pl
KLIMTOP CONTROLS - specjalista w zakresie technologii
dostarczanych dla przechowalnictwa. Firma posiada
w swojej ofercie na bieżąco udoskonalane urządzenia
wentylacyjno-chłodnicze oraz skrzyniopalety drewniane.
Korzystając z usług KLIMTOP Controls mogą Państwo
liczyć na pomoc we wszystkich kluczowych etapach swojej
inwestycji.
KNOTT Sp. z o. o.
Zdziechowice 100
63-011 Pławce
tel.: +48 61 287 60 00
fax: +48 61 287 60 01
e-mail: [email protected]
www.knott.pl
Elementy do przyczep. Osie,urządzenia najazdowe i układy
hamulcowe firmy KNOTT są stosowane w przyczepach samochodowych, przyczepach campingowych, przyczepach
do przewozu łodzi, przyczepach – furgonach, przyczepach
wysokiego ładowania oraz w pojazdach do przewozu bydła
i koni. Jesteśmy jednym z liderów wśród europejskich
producentów części do budowy przyczep.
Trailer components. Axles, overrunning hitches and braking
systems by KNOTT are used in car trailers, caravans, boat
trailers, box-type trailers, flatbed trailers and trailers for cattle
and horse transport. We are one of the leading manufacturers
of trailer components in Europe.
Stoisko: C 503
KMK Agro
ul. Poznańska 20, Brodowo
63-000 Środa Wlkp.
tel./fax: +48 61 285 01 79
tel./fax: +48 61 287 11 46
e-mail: [email protected]
www.kmkagro.com
Stoisko: C 73
FPUH KOBEX Stanisław Rembisz
Łowisko 240
36-053 Kamień
Biuro tel./fax: +48 15 838 10 16
e-mail: [email protected]
www.kobexstal.pl
KMK – wyposażenie przechowalni i linie pakujące; produkcja
własna; JOHN DEERE -ciągniki, kombajny; WM-Kartoffeltechnik –kombajny do ziemniaków; BOBCAT –ładowarki teleskopowe; UMEGA –przyczepy rolnicze; MX –ładowacze czołowe;
RM –deszczownie; MASCHIO – GASPARDO –siewniki,
agregaty uprawowo-siewne; KUHN –pługi, brony aktywne;
SIMON –kombajny do warzyw; AFFELDT –linie pakujące; ALLROUND –sortowniki, obcinarki itp.; REMPRODEX –maszyny
do uprawy i obróbki warzyw.
KMK – equipment of vegetable storage, rope packing; own
pruduction; JOHN DEERE -tractors, harvester; WM-Kartoffeltechnik – potatoes harvesters; BOBCAT –loaders;
UMEGA –trailer; MX –Front loaders; RM –irrigation machines;
GASPARDO –pneumatic drills; MASCHIO – GASPARDO –
machine to tillage of soil; KUHN -the ploughs, active harrows;
SIMON –combine harvester to vegetables; AFFELDT –rope
packing; ALLROUND –sorter, cutter etc.; REMPRODEX –the
device to tillage of vegetables.
Stoisko: F 301
Kobex jest producentem konstrukcji stalowych hal rolniczych,
magazynowych, obór, chlewni, kurników, tuczarni, itp. Oferujemy hale stalowe najwyższej jakości w atrakcyjnych cenach.
Wykonujemy fundamenty, zajmujemy się montażem hal. Wykonujemy obudowę oferowanych konstrukcji płytą warstwową
lub blachą trapezową. Klient wskazuje nam miejsce gdzie ma
stanąć planowana konstrukcja, my dbamy o resztę.
Kobex is a manufacturer of steel farm halls, warehouses,
sheds, barn, sheds, fattening, etc. We offer the highest quality
steel buildings at affordable prices. We foundations, we are
assembling halls. We offer housing construction sandwich
panels or trapezoidal. The client indicates to us the place where
you stand in the planned construction, we take care of the rest.
Stoisko: D 538
„Zavod Kobzarenka” Ltd
Rusanovskaya Str., 17
42500 pgt. Lipovaya Dolina, Sumskaya obl
Ukraina
tel./fax: +38 044 452 74 59
e-mail: [email protected]
www.kobzarenko.com.ua
Stoisko: F 250
63
Spis wystawców
List of exhibitors
Przedsiębiorstwo "Konar"jest nowoczesną firmą działającą
na naszym rynku od 20 lat. Produkuje kotły i nagrzewnice na
paliwa stałe z palnikiem groszkowo-miałowym EKOENERGIA
Nagrzewnice na paliwa stałe służą do ogrzewania dużych
kubatur tj: szklarnie tunele foliowe magazyny chlewnie hale
produkcyjne warsztaty.
KÖCKERLING GmbH & Co. KG
Lindenstrasse 11-13
D-33415 Verl
tel.: +49 (0) 5246 96 08 12
fax: +49 (0) 5246 96 08 21
Marketing i sprzedaż w Polsce:
mgr inż. Henryk Kozub
kom.: +48 691 983 037
kom.: +49 1705 95 73 29
e-mail: [email protected]
www.koeckerling.com
Stoisko: D 566
Stoisko: B 189
KOMATSU POLAND Sp. z o.o.
ul. Trakt Brzeski 72
05-070 Sulejówek
tel.: +48 22 783 00 63
fax: +48 22 760 12 97
e-mail: [email protected]
www.komatsupoland.pl
Komatsu Poland Sp. z o.o., wyłączny autoryzowany dystrybutor maszyn budowlanych japońskiego koncernu Komatsu na
terenie Polski, oferuje sprzedaż maszyn nowych i używanych,
oraz wynajem: spycharek, koparek gąsienicowych i kołowych,
ładowarek kołowych, koparko-ładowarek, mini koparek i mini
ładowarek, koparek gąsienicowych do wyburzeń, równiarek,
wozideł sztywnoramowych i przegubowych itp. Jesteśmy
dostawcą flot maszyn wykorzystywanych przy budowie
autostrad i w przemyśle wydobywczym. Zapewniamy
profesjonalną obsługę serwisową oraz dostawę oryginalnych
części zamiennych Komatsu. Jako pierwsi na rynku maszyn
budowlanych standardowo wyposażyliśmy nasze maszyny
w system satelitarnego monitorowania KOMTRAX™, zapewniający pełną i ciągłą kontrolę: stanu technicznego maszyny,
przebiegu jej pracy i lokalizacji. Nasza marka gwarantuje
wysoką jakość i niezawodność produktów oraz dbałość o
klienta.
Stoisko: D 218
Kongskilde Polska Sp. z o.o.
ul. Metalowa 15
99-300 Kutno
tel.: +48 24 355 96 15
fax: +48 24 355 96 35
e-mail: [email protected]
www.kongskilde.com
Kompletna oferta maszyn do uprawy, siewu i pielęgnacji
roślin: pługi ÖVERUM, agregaty do przedsiewnej uprawy
gleby, brony bierne i aktywne HOWARD, siewniki mechaniczne i pneumatyczne Kongskilde i Nordsten, siewniki
pneumatyczne Becker, pielniki rzędowe, brony talerzowe,
kultywatory podorywkowe i ścierniskowe, maszyny do
zbierania kamieni, systemy do suszenia i przechowywania
ziarna zbóż, systemy pneumatycznego transportu ziarna,
czyszczalnie wstępnego i dokładnego czyszczenia, magazyny podłogowe, ogrzewacze powietrza olejowe, gazowe
i elektryczne. Produkcja i sprzedaż maszyn do zbioru i
zagospodarowania zielonki oraz wozów paszowych firmy
JF-Stoll.
Complete soil preparation solutions: ÖVERUM ploughs, seedbed cultivators, HOWARD power harrows end rotavators, cultivators/drilling combinations, KONGSKILDE and NORDSTEN
seed drills, Becker precision drills, interrow cultivators, slurry
injectors, disc harrows, stubble cultivators, stone collectors,
complete grain handling systems, pneumatical transporters,
cleaning equipment, on floor storage, oil, gas and electric
heaters. The production and sales of the grassland machinery
and complete diet mixers of the company JF-Stoll.
Stoisko: E 300
KOMFORT Zakład Produkcyjno-Usługowo-Handlowy
Os. Cechowe 22
64-840 Budzyń
tel.: +48 67 284 34 83
fax: +48 67 283 45 15
e-mail: [email protected]
www.komfort.net.pl, www.regeneracja24.pl
Stoisko: D 94
P.H. Konrad
ul. Poligonowa 28 c
18-400 Łomża
tel.: +48 86 215 11 15
fax: +48 86 216 93 92
e-mail: [email protected]
www.phkonrad.com.pl
Stoisko: E575
P.H.U KONAR s.c.
ul. Krakowska 5
42-200 Częstochowa
tel.: +48 604 480 029
e-mail: [email protected], [email protected]
www.konar.co, www.nagrzewnice.co
64
KONSIL - Przedsiębiorstwo Obsługi Rolnictwa
ul. Nakielska 10
89-121 Ślesin
tel.: +48 52 385 78 59, 385 71 56
fax: +48 52 385 71 55
e-mail: [email protected]
www.konsil.pl
KONSIL oferuje: silosy zbożowe płaskodenne BIN o
pojemności od 10 do 2200 ton, przenosniki ślimakowe i
kubełkowe do silosów, kosze przyjęciowe, czyszczalnie,
K
wentylatory i nagrzewnice, kompleksowo najtańsze magazyny zbożowe w oparciu o silosy, rozdrabniacze, mieszalniki i
wagi do pasz.
We offer silos BIN and KONSIL, capacities from 100 to 100
tons and modern grain stores. By gravity and mechanical
hoppers.
handlers; CAPELLO – corn heads; FELLA – forage harvesting
machinery; SULKY – fertilizer spreaders, seed drills, soil
preparation machinery; MONOSEM – precision planters.
In offer also: Stoll, Gregoire-Besson, MX, Rabe, Berthoud.
Polish producers` agricultural machinery. Warranty and after
warranty service. Spare parts.
Stoisko: B 269
Stoisko: C 395
Produkcja Maszyn Rolniczych i Części Zamiennych
KOWALSCY Spółka Jawna
Działkowców 11
62-300 Września
tel./fax: +48 61 436 05 66, 622 25 86
e-mail: [email protected]
www.agro-kowalski.com.pl
Kopalnia Soli „KŁODAWA” S.A.
ul. Aleja 1000-lecia 2
62-650 Kłodawa
tel.: +48 63 273 32 00
fax: +48 63 273 05 45
e-mail: [email protected]
www.sol-klodawawa.com.pl
Kopalnia soli „Kłodawa” S.A. jest producentem naturalnej soli
kamiennej, lizawek solnych oraz soli do zimowego utrzymania
dróg. Skład mikroelementów występujących w kłodawskiej
soli jest zbliżony do osocza ludzkiej krwi, dzięki czemu sól ta
jest bardzo łatwo przyswajalna przez organizm.
Salt mine „Kłodawa” S.A. is a producer of natural rock salt,
lick-stones, and salt for road maintence (de-icing salt).
Composition of our salt is approximated to serum of human
blood. That is why our salt is easy to be adopted by human
organism.
Stoisko: B 339
Produkcja Maszyn Rolniczych i Części Zamiennych KOWALSCY Spółka Jawna posiada w swojej ofercie maszyny rolnicze
oraz części zamienne do maszyn rolniczych. Jesteśmy
producentem: -kosiarek rotacyjnych, bębnowych, dyskowych,
bijakowych (mulczerów); przetrząsaczy karuzelowych; stołów
do rzepaku do kombajnów produkcji krajowej oraz do NEW
HOLLAND, JOHN DEERE, FORTSCHRITT, CLAAS, DEUTZ
FAHR, FENDT i innych.
Production of Agricultural Machines and Spare Parts
KOWALSCY Spółka Jawna offers agricultural machines and
spare parts for agricultural machines. We manufacture:rotary,
drum, disc and flail (mulcher) mowers; rotary tedders; rape
table extensions for harvesters manufactured in Poland and
for NEW HOLLAND, JOHN DEERE, FORTSCHRITT, CLAAS,
DEUTZ FAHR, and other.
Stoisko: A 1
Korbanek Sp. z o.o.
ul. Poznańska 159
62-080 Tarnowo Podgórne
e-mail: [email protected]
www.korbanek.pl
+48 61 895 03 00 centrala
+48 61 895 03 01 maszyny
+48 61 895 03 02 serwis www.serwis.korbanek.pl
+48 61 895 03 03 części www.sklep.korbanek.pl
+48 61 895 03 09 fax
Generalny sprzedawca maszyn rolniczych w Polsce: FENDT
– kombajny, ciągniki, prasy; MASSEY FERGUSON – kombajny, ciągniki, prasy, ładowarki; CAPELLO – przystawki do
kukurydzy; FELLA – maszyny zielonkawe; SULKY – siewniki,
rozsiewacze, agregaty uprawowo-siewne; MONOSEM
– siewniki punktowe. W ofercie również: Stoll, Gregoire-Besson, MX, Rabe, Berthoud. Maszyny rolnicze polskich
producentów. Serwis gwarancyjny i pogwarancyjny. Części
zamienne.
The General Distributor of agricultural machinery in Poland:
FENDT – combine harvesters, tractors, balers; MASSEY FERGUSON – combine harvesters, tractors, balers and telescopic
Kramer-Werke GmbH
Wacker Neuson Str. 1
88630 Pfullendorf
tel.: +49 (0)7552 9288-0
fax: +49 (0)7552 9288-234
e-mail: [email protected]
www.kramer-online.com
Kramer-Werke GmbH projektuje i produkuje kompaktowe ładowarki dla rolnictwa. Paleta produktowa obejmuje ładowarki
kołowe, nośniki teleskopowe oraz kompaktowe ładowarki
teleskopowe o wysięgu do 6 m i nośności do 2,5 t.
Stoisko: D 214
Kramp Sp. z o.o.
ul. Grunwaldzka 519C
62-064 Plewiska k./Poznania
tel.: +48 61 639 19 60
fax: +48 61 651 78 08
e-mail: [email protected]
65
Spis wystawców
List of exhibitors
Kramp to holenderska firma zajmująca się sprzedażą hurtową
części zamiennych od 1951 r. W ofercie posiada ponad 500
000 produktów dla rolnictwa, pielęgnacji terenów zielonych,
przemysłu leśnego, robót ziemnych i budowy dróg. Kramp
w Polsce sprzedaje z powodzeniem swoje produkty od 2012
roku.
Stoisko: C 42
KST Konsulting oferuje szeroki zakres usług zarządzania gospodarstwem. Obejmują one doradztwo techniczne zarządzania gospodarstwem rolnym, specjalistyczne oprogramowanie
dla upraw oraz zarządzania stadem mlecznym, jak również
specjalistyczne usługi biura rachunkowego.
KST Konsulting provides a range of farm management services. These include technical consultancy, farm management,
specialist software for crop and cow management as well as
a specialist farming accounting office.”
Stoisko: C 496
KREBECK GmbH
Osterdammer Strasse 34
D-49401 Damme, Niemcy
tel.: + 49 54 919 66 70
fax: + 49 54 919 66 750
e-mail: [email protected]
www.krebeck-damme.de
Przedstawicielstwo w Polsce:
Plottnik AgroConsulting
ul. Św. Ducha 120
63-200 Jarocin
tel./fax: +48 62 505 00 01
Rafał Iwan
Przedstawiciel handlowy
kom.: + 48 692 204 661
e-mail: [email protected]
Waldemar Plottnik
tel.: + 49 2545 919 313
tel.: + 49 16 095 979 711
e-mail: [email protected]
Kubota (Deutschland) GmbH Sp. z o.o. Oddział w Polsce
ul. Jutrzenki 118
02-230 Warszawa
tel.: +48 22 868 42 33, 868 42 34
fax: +48 22 868 36 58
e-mail: [email protected]
www.traktorykubota.pl
Firma Kubota (Deutschland) GmbH Sp. z o.o. Oddział w
Polsce jest wyłącznym dystrybutorem japońskich ciągników
rolniczych, ciągników średniej mocy, miniciągników i kosiarek
profesjonalnych marki Kubota. Obecna gama obejmuje
maszyny o mocy od 12 do 140 KM wyposażone w znane z
oszczędności silniki Diesla marki Kubota oraz w rozwiązania
techniczne gwarantujące dużą żywotność i niezawodność
oferowanych produktów.
Krebeck jest od ponad 40 lat przodującym niemieckim
producentem automatycznych instalacji karmienia na mokro,
karmienia na sucho oraz kompletnych systemów wyposażenia chlewni. Wszelkie elementy instalacji od koryta ze stali
nierdzewnej, poprzez pompy, zawory, automaty paszowe do
komputerów i ich o programowania są z własnej produkcji.
Dzięki temu możemy wypełnić życzenia i wymogi naszych
klientów i należymy do liderów tej branży w bardzo wymagającym rynku zachodnich Niemiec. „.niezawodne,. trwałe,.
łatwe w obsłudze. tanie” to są zasady, którymi się kierujemy
w rozwiązaniach dla naszych klientów.
Kubota (Deutschland) GmbH Sp. z o.o. Oddział w Polsce is
the sole distributor of Kubota agricultural tractors, mid-range
tractors, compact tractors, and ground care equipment in
Poland. The current product range includes machines from
12 to 140 HP, fitted with fuel efficient Kubota Diesel engines
and technical features that guarantee long lifespan and high
reliability of the offered products.
Stoisko: A 268
Stoisko: C 404
KUHN-MASZYNY ROLNICZE Sp. z o.o.
Jelonek, ul. Orzechowa 1
62-002 Suchy Las
tel.: +48 61 812 52 35
fax: +48 61 811 70 10
kom.: +48 507 099 559
www.kuhn.com.pl
Kruszec Zakład Usługowo Produkcyjny
Tczyca 3
32-250 Charsznica
kom.: +48 606 897 368
e-mail: [email protected]
www.kruszec.pl
Stoisko: C 519
KST Konsulting Sp. z o.o.
ul. Poznańska 13
63-004 Tulce
tel.: +48 61 887 66 08
fax: +48 61 887 66 09
kom.: +48 795 122 757
e-mail: [email protected]
www.kstkonsulting.com.pl
66
KUHN - Maszyny Rolnicze Sp. z o.o. jest oddziałem
handlowym firmy KUHN SA, światowego lidera w produkcji
i sprzedaży maszyn rolniczych. W ofercie firmy znajdują
się: pługi, maszyny uprawowe, siewniki, opryskiwacze,
rozsiewacze nawozów, maszyny zielonkowe, prasy rolujące
i kostkujące, prasoowijarki i owijarki do bel, sieczkarnie do
kukurydzy, wozy paszowe i maszyny do ścielenia słomą,
rozdrabniacze, maszyny do pielęgnacji terenów zielonych,
rozrzutniki obornika
L
KUHN – Maszyny Rolnicze Sp. z o.o. is a Polish subsidiary of
KUHN SA specialized in design, production and marketing of
agricultural machinery. The range currently offered embraces
ploughing, soil preparation, spraying, seeding, hay / silage
making, baling & wrapping, fertilization, shredding, landscape
maintenance, bedding & feeding.
Stoisko: B 272
Krukowiak Kujawska Fabryka Maszyn Rolniczych Sp. z o.o.
ul. Kolejowa 54
87-880 Brześć Kujawski
tel.: +48 54 252 10 27
fax: +48 54 252 10 54
e-mail: [email protected]
www.krukowiak.com.pl
KFMR KRUKOWIAK jest firmą produkującą maszyny rolnicze,
specjalizującą się głównie w produkcji opryskiwaczy
polowych i sadowniczych. W ofercie również znajdują się maszyny do zbioru cebuli, ziemniaków oraz maszyny sadownicze
i do warzyw.
KFMR KRUKOWIAK is a company that produces agricultural
machines. Company’s specialty are mainly field and orchard
sprayers. We also produce machines for onions, potatoes,
vegetables and orchard.
Stoisko: C 203
Kverneland Group Polska Sp. z o.o.
ul. Kręta 87
87-100 Toruń
tel.: +48 56 651 30 53
fax: +48 56 621 90 99
http://pl.kvernelandgroup.com
Kverneland – pługi, kultywatory, brony, siewniki, rozsiewacze,
opryskiwacze, maszyny do zbioru zielonek.
fax: +48 61 873 88 08
e-mail: [email protected]
www.kws.pl
KWS jest niezależnym przedsiębiorstwem hodowlano –
nasiennym dla rolników XXI wieku. KWS Polska zajmuje się
rozprowadzaniem materiału siewnego buraka cukrowego
(NEVENKA, BRITANNIA, DANUŚKA KWS, JULIETTA),
kukurydzy (RONALDINIO,PODIUM,AMADEO), rzepaku
(SHERLOCK, DIGGER, HYBRIGOLD), ziemniaka (INOVA,
RAMOS) oraz działalnością doradczą w zakresie uprawy
tych roślin.
Stoisko: B 354, B 355
Lantmännen SW Seed Sp. z o.o.
ul. Głowackiego 1A
05-822 Milanówek
tel.: +48 501 280 275
www.swseed.pl
Hodowla dla przyszłości. Lantmännen SW Seed jest
międzynarodową firma hodowlano-nasienną należącą do
szwedzkiej rolniczej grupy producenckiej Lantmännen. Jej
główne kierunki działalności to hodowla nowych odmian oraz
produkcja materiału siewnego. Hodowla roślin SW obejmuje
ponad 20 gatunków roślin uprawnych. SW jest jednym z
głównych dostawców nasion rzepaku ozimego oraz pszenicy
ozimej na polskim rynku.
Breeding for the future. SW is an international plant-breeding
and seed group belongs to Swedish farmer’s Group Lantmännen. The group’s core activity consists of developing new
varieties and producing seed. SW carries the plant breeding
of more than twenty crops. SW is one of main providers of
winter rape and winter wheat seeds on Polish market.
Stoisko: B 364
Kverneland - ploughs, cultivators, harrows, seed drills, spreaders, sprayers, grass machinery.
Stoisko: B 271
Kwazar Corporation Sp. z o.o.
ul. Chełmońskiego 144
96-313 Jaktorów
tel.: +48 46 856 40 30
fax: +48 46 856 41 33
e-mail: [email protected]
www.kwazar.com.pl
Stoisko: C 66
KWS POLSKA Sp. z o.o.
ul. Chlebowa 4/8
Poznań 61-003
tel.: +48 61 873 88 00
P.P. "LE-GUM"
Handel i Serwis
Urządzeń Wulkanizacyjnych
ul. Poznańska 20a
66-440 Skwierzyna
tel./fax: +48 95-717 21 93, 95 717 08 98
Dział Handlowy: kom.: +48 696 954 487, 513 098 395
e-mail: [email protected], [email protected]
www.legum.pl
LE-GUM realizuje projekty związane z kompleksowym
wyposażeniem serwisów ogumienia (osobowe, ciężarowe,
rolnicze) oraz warsztatów samochodowych. Oferta zawiera
urządzenia uznanych europejskich producentów. Firma
prowadzi szkolenia, serwis gwarancyjny i pogwarancyjny oraz
montaż zgodny z SEP i UDT.
67
Spis wystawców
List of exhibitors
LE-GUM Company implements projects related to complex
equipment tire services (passenger cars, trucks, agricultural)
and garages. The offer includes the units of Europe's leading
manufacturers. The LE-GUM Company provides a training,
warranty and after warranty service and installation complies
with the SEP and UDT.
WYTWÓRNIA PASZ LIRA Sp. z o. o.
ul. Gen. Chłapowskiego 36
64-010 Krzywiń
tel./fax: +48 65 517 43 00, 65 17 43 02
e-mail: [email protected]
www.lira-pasze.pl
Stoisko: E 583
Stoisko: E 126
Logis Sp. z o.o.
Towarowa 18
62-052 Komorniki
tel.: +48 61 664 69 00
fax: +48 61 664 69 01
e-mail: [email protected]
www.logis.pl
Lely East Sp. z o.o.
Ciele, ul. Toruńska 18
86-005 Białe Błota
tel.: +48 523 211 133
fax +48 523 211 144
e-mail: [email protected]
www.lely.com
Stoisko: C 517
Lely jest niekwestionowanym liderem na rynku produktów i
usług w zakresie zautomatyzowanego systemu doju, przygotowania i zadawania pasz oraz innych robotów, które automatyzują pracę w oborze. Firma zajmuje także silną pozycję na
rynku maszyn do szybkiego zbioru pasz objętościowych. Lely
podejmuje wszelkie możliwe starania, aby zapewnić swoim
klientom zrównoważoną, dochodową i świetlaną przyszłość
w rolnictwie.
Stoisko: E 296
LEMKEN POLSKA Sp. z o.o.
Żalęcino
73-115 Dolice
tel.: +48 91 563 76 46
fax: +48 91 563 76 04
www.lemken.com.pl
Stoisko: F 308
LSN LUBLIN
ul. B. Głowackiego 35
20-060 Lublin
tel./fax: +48 81 442 75 32
e-mail: [email protected]
www.lsn.pl
LSN Lublin jest firmą produkcyjną prowadzącą swoją
działalność od 1945r. LSN zajmuje się m.in. produkcją
wyrobów elektrotechniki motoryzacyjnej, takich jak: Instalacje
elektryczne ciągników, wiązki i złącza elektryczne przyczep,
stacyjki ciągnikowe oraz przełączniki dźwigienkowe. Firma
realizuje politykę jakości zgodnie ze standardami ISO 9001, a
także posiada status Zakładu Pracy Chronionej.
LSN Lublin is a production company operating since
1945. We manufacture electronic products for vehicles,
including: Electric systems for tractors, wire harnesses and
connections for trailers, tractor ignitions and lever switches.
The company maintains the quality policy in accordance
with ISO 9001 standards, and has a status of a protected
labour plant.
Stoisko: hala 34
LIBERO sp. z o.o
Wolkowo 18
64-111 Osieczna
tel.: +48 65 545 63 03
kom.: +48 698 683 301
LIBERO Sp. z o.o. to firma z 20 letnim doświadczeniem
w skupie macior, knurów, tuczników i bydła. Duży nacisk
kładzie na osobiste kontakty z hodowcami w Polsce i właścicielami największych firm przemysłu mięsnego w Europie.
Dzięki takiej polityce zdobyła znaczny udział w rynku. LIBERO
dysponuje nowoczesnym, specjalistycznym transportem do
przewozu trzody chlewnej oraz bazą umożliwiającą organizowanie skupu na dużą skalę. Działa na terenie całej Polski, ze
szczególnym naciskiem na Wielkopolskę i zachodnie regiony
kraju. Nowością jest sprzedaż prosiąt z Niemiec, Danii i
Holandii.
Stoisko: F 489
68
LUCAS G.
22 rue du stade – CS 80009
F – 85130 LA VERRIE
France
tel.: + 33 251654136
fax: + 33 251654151
e-mail: [email protected]
www.lucasg.fr
LUCAS : French manufacturer of machinery for cattle: mixers,
feeders, straw-bedders, bale choppers. 40 years of agricultural innovation in breeding equipments.
Stoisko: B 27
L
Przenośniki taśmowe. Transportery warzyw. Wagopakowarki
i inne. Polerka warzyw (szczotkarka warzyw) – nowość.
Platforma rolnicza z transporterem warzyw – nowość.
Ludwig Bergmann GmbH Maschinenfabrik
Hauptstraße 64-66
49424 Goldenstedt
Niemcy
tel.: +49 (0) 4444 20050
fax: +49 (0) 4444 200888
e-mail: [email protected]
www.bergmann-goldenstedt.de
Stoisko: F 258
Vegetable seeders. Rotary planters for vegetables and
potatoes. Furrow-forming equipment. Machines for covering
vegetables with agricultural nonwoven. Washers. Carrot
cutters. Belt conveyers. Vegetable conveyors. Weighting and
packing machines, and others.
Stoisko: F 240
Firma Handlowa LUPUS
ul. Mleczarska 6
06-400 Ciechanów
tel.: +48 23 673 26 04
tel./fax: +48 23 673 14 96
e-mail: [email protected]
www.lupus-wilk.pl
Stoisko: A 265
LUVENA S.A.
ul. Romana Maya 1
62-030 Luboń
tel.: +48 61 89 00 200
fax: +48 61 89 00 404
bezpłatna infolinia: 0 800 161 026
e-mail: [email protected]
www.luvena.pl
LUVENA S.A. jest jednym z wiodących w Polsce producentów
nawozów rolniczych oraz ogrodniczych. Oferujemy granulowane
nawozy rolnicze (Lubofoska, Lubofos, Luboplon) oraz nawozy
pyliste i superfosfaty. Działkowcom oraz właścicielom ogrodów
oferujemy nawozy ogrodnicze z serii,,Słoneczne Ogrody”.
LUVENA has actively co-operated with farmers all over Poland
and abroad, supplying them with multi-component fertilizers
of the highest quality. We offer fertilizers granulated such as
Lubofoska or Superphosphates, granulated fertilizers produced by compression, namely Lubofoses, as well as powdered
fertilizers.
Stoisko: A 325
ŁUKOMET Krzysztof Łuszczyk
Całowanie 91a
05-480 Karczew
tel.: +48 22 780 76 87
fax: +48 22 780 63 55
e-mail:[email protected]
www.lukomet.pl
Firma specjalizuje się w imporcie, produkcji i sprzedaży
maszyn i urządzeń do nawadniania upraw polowych oraz rolniczego zagospodarowania gnojowicy. Posiadamy sprawnie
działający serwis oraz bogaty magazyn części zamiennych.
Współpracujemy z najlepszymi europejskimi i światowymi
producentami maszyn: IRTEC, VALLEY, SIME, ROVATTI,
RAESA, BAUER oraz CRI-MAN, VENERONI, RIV, DODA.
Wszystkich obecnych i przyszłych Klientów zapraszamy do
zapoznania się z naszą ofertą. DORADZTWO, KOMPLETACJA,
MODERNIZACJA, SERWIS.
Our firm specialize in importation, production and sale of machines and equipment for field crops irrigation and for slurry
technology. We have efficient service and wide stock of spare
parts. We cooperate with European and global manufactures of the machines like. IRTEC, VALLEY, SIME, ROVATTI,
RAESA, BAUER and CRI-MAN, VENERONI, RIV, DODA. All
present and future clients we invite to familiarize yourself
with our offer. ADVISE & ASSEMBLING & MODERNIZATION
& SERVICE
Stoisko: C 202
Madar Renata Schmidt
Nowa 6
59-225 Chojnów
tel.: +48 881 206 316
e-mail: [email protected]
www.apsmachines.pl
Stoisko: F 152
ŁUCZAK Maszyny Rolnicze
Stanisław Łuczak
Bartochów 9
98-290 Warta
tel./fax: +48 43 829 43 96
e-mail: [email protected]
www.luczakmaszyny.pl
Pielniki, Eko-Pielnik, siewniki warzyw. Sadzarki karuzelowe
warzyw, ziemniaków. Formatory redlin. Przykrywarki warzyw
agrowłókniną. Płuczki. Maszyny do obcinania marchwi.
Madejski Spółka Jawna
ul. Makuszyńskiego 28
31-752 Kraków
tel.: +48 12 643 67 67, 12 683 96 00
fax: +48 12 683 96 42
biuro: [email protected]
informacja: [email protected]
maszyny: [email protected]
69
Spis wystawców
List of exhibitors
motoryzacja: [email protected]
węże przemysłowe: [email protected]
www.madejski.com.pl
Firma Madejski Spółka Jawna istnieje od 1995 roku. Zajmujemy
się produkcją i sprzedażą: przewodów wysokiego i niskiego ciśnienia, węży do produkcji przewodów, wszelkiego rodzaju zakuć
i końcówek, złączy i rur, szybkozłączy, zaworów, manometrów,
maszyn do produkcji przewodów, a także części zamiennych do
samochodów ciężarowych, autobusów, przyczep i naczep.
MALINMAR Janina Malinowska
ul. Wójcicka 10, Bystrzyca
55-200 Oława
tel.: +48 71 303 06 51
tel./fax: +48 71 313 36 90
kom.: +48 695 760 901
e-mail: [email protected]
www.malinmar.pl
The Madejski Company, established in 1995, produces and
sells: high and low pressure assembled hoses, hoses for
the production of assembled hoses, all types of ferrules and
fittings, adapters and pipes, fastcouplings, valves, pressure
gauges, machines for the production of assembled hoses,
spare parts for trucks, busses and trailers.
Produkcja kół jezdnych rolniczych,obręczy,półobręczy,piast,czopów.Plastyczna i mechaniczna obróbka metali.
Podstawowe rozmiary kół:4.00x4,4.00x8,4.00x10,5.00x9
,15x6.00-6,16x6.5-8,18x9.50-8,20x8.00-10.Podstawowe
rozmiary obręczy:2.50x4,2.50x8(w kilku odmianach),2.50x10
,5.00x9,4.50x6,5.50x8.
Stoisko: hala 18
Production of agricultural land wheels,rims,semi-rims,hubs,pins.
Plastic and mechanic metal machining.Basic wheel diameters:
4.00x4,4.00x8,4.00x10,5.00x9,15x6.00-6,16x6.5-8,18x9.50-8,20x8.00-10.Basic rim diameters:2.50x4,2.50x8(several
versions),2.50x10,5.00x9,4.50x6,5.50x8.
MADOKS Dariusz Przegaliński
Królewska 105
05-882 Milanówek
tel.: +48 501 008 919
e-mail: [email protected]
www.madoks.eu
Stoisko: hala 17
Stoisko: C 529
MAGROTEX PPU Sp. z o.o.
ul. Fabryczna 1
59-225 Chojnów
tel./fax: +48 76 818 85 26, 76 818 83 29
e-mail: [email protected], [email protected],
[email protected]
www.magrotex.pl
Nasza firma posiada najszerszą ofertę w zakresie przenośników
ślimakowych (17 rodzajów) o długości roboczej od 4 m do 12
m, wydajności od 8 t/h do 50 t/h. Możliwość wykonania przenośnika „na wymiar”. Ponadto oferujemy linie przygotowania i
mieszania pasz, rozdrabniacze bijakowe oraz gniotowniki.
Stoisko: C 388
Małopolska Hodowla Roślin HBP Sp. z o.o.
ul. Zbożowa 4
30-002 Kraków
Tel:+48 12 633 68 22, 12 633 68 23
tel./fax: +48 12 633 02 25
e-mail: [email protected]
www.hbp.pl
Oferuje kwalifikowane nasiona własnej hodowli. Materiał
siewny:buraki pastewne wielo- i jednokiełkowe, mieszanki
traw gazonowych i pastewnych, zboża jare i ozime, kukurydzę
siewną i cukrową, nasiona traw, okopowe pastewne, mieszanki
strączkowo-zbożowe, ziemniaki sadzeniaki, rośliny motylkowe
grubo i drobnonasienne. Nasiona konsumpcyjne i paszowe.
Stoisko: B 360
Makita Sp. z o.o.
ul. Bestwińska 103
43-346 Bielsko-Biała
tel.: +48 33 484 02 23
fax: +48 33 816 45 24
e-mail: [email protected]
www.makita.pl
Profesjonalne pilarki łańcuchowe elektryczne i spalinowe,
wykaszarki, wycinarki oraz kosiarki trawnikowe.
Professional electric and petrol chain saws, bruch cutters and
lawn mowers.
Stoisko: F 241
70
PPH MANDAM Sp. z o.o.
44-100 Gliwice
ul. Toruńska 2
tel.: +48 32 232 26 60
fax: +48 32 232 58 85
e-mail: [email protected]
www.mandam.com.pl
Na rynku maszyn rolniczych jesteśmy już 22 lata. W ofercie
posiadamy maszyny rolnicze do: płytkiej i głębokiej uprawy
(kultywatory, brony talerzowe); upraw przedsiewnych (agregaty przedsiewne, wały); uprawy łąk (brony łąkowe, walce
łąkowe); mechanizacji robót rolniczych (chwytaki bel, nośniki
M
palet, łyżki). Ponadto prowadzimy działalność w zakresie handlu: kosiarkami bijakowymi firmy M.E.A.A.T oraz TIFERMEC;
odśnieżarkami firmy TREJON.
Mandam is well recognized company producing agricultural
equipment in Poland. Currently the company has in the offer
agricultural machinery: for soil cultivation, for pre-sowing and
pre-seeding cultivation, for tillage of grasslands, for mechanizing agricultural works.
Stoisko: D 224
sie najlepszym stosunkiem ceny do jakości. Jako bezpośredni importer mamy najlepsze ceny, najlepsze produkty,
pełny asortyment części zamiennych. Szukamy dealerów,
oferujemy atrakcyjne warunki sprzedażowe i serwisowe.
Więcej na www.kerona.pl; www.xaram.pl; www.marax.pl.
MARAX Import-Export a direct importer and manufacturer
of heating equipment. We produce and import gas heaters,
electric, oil, used oil, water heaters. We make Kerona (2
years g) - the best oil heaters on the Polish market, and
XARAM Energy heaters - heaters are characterized by the
best value for money. As a direct importer we have the best
prices, the best products, full range of spare parts. We are
looking for dealers offer attractive terms of sales and service. More www.kerona.pl; www.xaram.pl; www.marax.pl.
Stoisko: E 444
MANITOU Polska Sp. z o.o.
Sękocin Stary, ul. Mszczonowska 86
05-090 Raszyn
tel.: +48 22 739 48 20
fax: +48 22 739 48 32
e-mail: [email protected]
www.pl.manitou.com, www.mlt.manitou.com
Grupa MANITOU to jeden z wiodących producentów ładowarek teleskopowych na świecie. Marki MANITOU, GEHL i
MUSTANG dostarczają uniwersalne ładowarki teleskopowe,
przegubowe i burtowe (typu skid) wraz z wyspecjalizowanymi osprzętami oraz wózki widłowe dla branży rolniczej,
budowlanej, komunalnej i przemysłowej. Zapraszamy na
stoisko Grupy na AGROSHOW - oferujemy: pomoc doradców
w porównaniu oferty rynkowej, zapisy na bezpłatne testy maszyn, rabaty na oryginalne osprzęty oraz gadżety reklamowe
na pamiątkę spotkania.
The MANITOU Group is one of the world’s leading manufacturers of telehandlers. The MANITOU, GEHL and Mustang
brands provide telescopic, articulated and skid telehandlers
as well as forklifts for agriculture, construction, municipal
services and industry. Meet us at the AGROSHOW Fair. We
will offer assistance of competent advisers in comparing
market offer, free machine tests, discounts on original
attachments and promotional gadgets as a keepsake of our
meeting.
Stoisko: E 295
Market Rolniczy Minge Sp. z o.o.
Centrala:
ul. Poznańska 78
62-066 Granowo
tel.: +48 61 444 67 34
fax: +48 61 442 60 68
e-mail: [email protected]
www.mrminge.com.pl
Oddział Grodzisk:
ul. Bukowska 85
62-065 Grodzisk Wlkp.
tel./fax: +48 61 444 64 89
e-mail: [email protected]
www.mrminge.com.pl
Kompleksowe zaopatrzenie rolnictwa w środki do produkcji
rolnej. Sprzedaż hurtowa i detaliczna środków ochrony roślin,
nawozów, folii ogrodniczych i budowlanych. Skup płodów
rolnych. Profesjonale doradztwo.
Stoisko: A 317
Marma Polskie Folie
Al. Pod Kasztanami 10
35-030 Rzeszów
tel.: +48 17 850 66 00
fax: +48 17 850 66 13
e-mail: [email protected]
www.marma.com.pl
Stoisko: C 511
MARAX Import - Eksport
ul. Makuszyńskiego 24
31-752 Kraków,
tel.: +48 12 643-66-01 w.25; +48 12 642-27-80 w.25
e-mail: [email protected]
1-www.kerona.pl; 2-www.xaram.pl; 3-www.marax.pl
GG: 4529990
MARAX Import-Eksport to bezpośredni importer oraz
producent urządzeń grzewczych. Produkujemy i importujemy nagrzewnice gazowe, elektryczne, olejowe, na olej
zużyty, nagrzewnice wodne. Mamy marki KERONA (2 lata
gw)- najlepsze nagrzewnice olejowe na rynku polskim, oraz
nagrzewnice XARAM Energy - ogrzewacze charakteryzujące
MAROLEX Sp. z o.o.
Dziekanów Leśny, ul. Reymonta 2
05-092 Łomianki
tel.: +48 22 751 30 16
fax: +48 22 751 02 77
e-mail: [email protected]
www.marolex.pl
Stoisko: C 64
Mascar Spa
via Roma, 82
36040 Grumolo delle Abbadesse (VI)
Włochy
tel.: +39 0444 380 180
71
Spis wystawców
List of exhibitors
fax: +39 0444 583 831
e-mail: [email protected]
www.mascar.it
Stoisko: B 179
Maschio-Gaspardo Poland Sp. z o.o.
ul. Wapienna 6/8
87-100 Toruń
tel.: +48 56 650 60 51
fax: +48 56 650 60 53
e-mail: [email protected]
www.maschionet.com
Stoisko: A 262
P.P.H.U. „MAXYGEN” EXPORT-IMPORT
Sylwia Dudek
Andrzejów, ul. Wrocławska 43
98-432 Łubnice
tel.: +48 62 78 36 693 - biuro
kom.: +48 601 476 432 – doradca klienta
/Relationship Manager – Rafał Kowalski
e-mail: [email protected]
[email protected]
www.maxygen-dudek.eu
tel.: +48 85 712 45 20
fax: +48 85 712 45 70
kom.: +48 608 763 190
e-mail: [email protected]
www.mechanik-sc.pl
www.mechanik-sc.eu
„Mechanik” s.c. hurtownia najwyższej jakości części zamiennych do zachodnich maszyn rolniczych. W ofercie znajdą
Państwo m.in. części do ciągników rolniczych: John Deere,
Massey Ferguson David Brown, Landini, Claas, Renault,
Valtra, Valmet, Case IH, Ford, Fendt, Deutz, New Holland, Fiat,
Same, Deutz Fahr, silników wysokoprężnych: Deutz, Perkins,
MWM, Valmet-Sisu, Caterpillar, Cummins, Case, John Deere,
Ford, Same, kombajnów zbożowych oraz pras, agregatów,
siewników, pługów itp. Oficjalny dealer na Polskę części marki
Bepco Tractor Parts. Pasy – łańcuchy – części – pompy
hydrauliczne – filtry.
„Mechanik” s.c. multi-brand supplier and distributor of high
quality spare parts for agricultural machines and tractors:
John Deere, Massey Ferguson David Brown, Landini, Claas,
Renault, Valtra, Valmet, Case IH, Ford, Fendt, Deutz, New
Holland, Same, Deutz Fahr and diesel engines: Deutz, Perkins,
MWM, Valmet-Sisu, Caterpillar, Cummins, Case, John Deere,
Ford, Same. Agri-belts – agri-chains – spare parts – hydraulic
pumps – filters.
Stoisko: F 145
Główną działalnością naszej firmy jest produkcja i sprzedaż
nasienia knurów czystorasowych jak i hybrydowych
pochodzenia krajowego oraz zagranicznego. W 2010 r.
poszerzyliśmy działalność w zakresie przechowywania
i dystrybucji nasienia buhajów. Możemy poszczycić się
współpracą z takimi partnerami jak: RSA, CRV. Przewidujemy: organizowanie szkoleń, wyjazdy edukacyjne, komp.
dobór buhajów.
Our major activity is the manufacture and sale of semen from
boars pure and hybrid of national origin and foreign. In 2010,
we expanded the functions of storage and distribution of semen from bulls. We pride ourselves in working with partners
such as RSA, CRV. We predict: organizing training courses,
educational trips, computer selection of bulls.
Stoisko: F 472
McHale Engineering Limited,
Castlebar Road,
Ballinrobe,
Co. Mayo, Ireland.
tel.: +353 (0)94 95 20300
fax: +353 (0)94 95 20356
e-mail: [email protected]
Stoisko: D 291
Mechanika Maszyn i Urządzeń Rolniczych Tomasz
Pinkowski
ul. Przemysłowa 38
62-100 Wągrowiec
tel./fax: +48 67 262 24 00, 262 03 80
e-mail: [email protected]
www.mmiur.com
MMIUR Wągrowiec jest firmą produkcyjną z 30-letnim doświadczeniem. Jesteśmy producentem rozdrabniaczy słomy
do kombajnów zbożowych, przystawek do zbioru rzepaku,
rozsiewaczy nawozów. Produkujemy również części zamienne
do kombajnów zbożowych produkcji krajowej i zagranicznej
w tym: przenośniki łańcuchowe, podajniki ślimakowe, sita
żaluzjowe, klepiska a także obrotnice do przyczep rolniczych.
Zapraszamy do współpracy.
MMIUR Wągrowiec is a manufacturing company with 30
years experience. We are a manufacturer of straw choppers
for combine harvesters, headers extension for rape, fertilizer
distributors. We also produce spare parts for combine
harvesters domestic and foreign production including: elevator
chains, augers surface, flap sieves, concaves, and trailers
turntables. We invite you to cooperation.
Stoisko: E 116
MECHANIK S.C.
ul. Wesoła 3
16-200 Dąbrowa Białostocka
72
M
Mec-Pol Suszarnie
os. XXX-lecia PRL 7
57-230 Kamieniec Ząbkowicki
tel.: +48 74 817 48 40
e-mail: [email protected]
www.mec-pol.pl
tel.: +48 606 407 405
e-mail: [email protected]
Stoisko: D 416
Otto Th. Menke Polska Sp. z o.o.
ul. Poznańska 135
62–052 Komorniki
tel.: +48 61 842 05 82
fax: +48 61 842 05 83
e-mail: [email protected]
www.otto-th-menke.pl
Hurtownik części zamiennych do zachodniego sprzętu rolniczego, części zamienne najwyższej jakości za rozsądną cenę.
Koncern AGI do którego należy m.in. firma MEPU OY jest
jednym z największych na świecie dostawców osprzętu do
magazynowania, transportu i suszenia zboża. Sama firma
MEPU to producent najwyższej klasy suszarni do wszelkiego
rodzaju zbóż, wykorzystujących najnowsze technologie do
zapewnienia najbardziej ekonomicznej i ekologicznej metody
suszenia ziaren. W ramach oferty koncernu AGI jesteśmy
również dostawcą kompletnych rozwiązań systemów silosowych oraz systemów do wewnętrznego transportu ziarna.
AGI who owns MEPU OY is one of the world biggest supplier
of grain storage, transport and drying equipment. The company MEPU OY itself is a manufacturer of superior dryers for all
types of grains, using the latest technology to ensure the most
economical and environmentally friendly method of drying
grain. AS a part of AGI we are also a supplier of complete
solutions for silo systems and systems for handling grain.
Stoisko: D 294
The wholesaler of spare for agricultural equipment from the
West Europe, highest quality spare parts AT reasonable prices.
Stoisko: C 45
MEPROZET KOŚCIAN S.A.
ul. Gostyńska 71
64-000 Kościan
tel.: +48 65 512 53 25
fax: +48 65 512 11 62
e-mail: [email protected]
www.meprozet-koscian.eu
Największy i najstarszy polski producent WOZÓW ASENIZACYJNYCH. Nasza oferta obejmuje szeroką gamę wozów o
poj. 2300-28000 L, aplikatorów talerzowych i redlicowych,
dozowników naglebowych oraz dodatkowego wyposażenia.
NOWOŚĆ w naszej ofercie to kontener asenizacyjny o poj.
od 2500 - 24000 L przystosowany do załadunku w systemie
hakowym oraz wozy z poidłami dla zwierząt.
The biggest and the oldest Polish SLURRY TANKERS
manufacturer. Our offer comprises wide range of tankers with
capacity 2300 – 28000 litres, disc blade and coulter applicators, liquid manure dispensers and additional equipment. NEW
PRODUCTS in our offer are slurry containers with capacity
from 2500 - 24000 l adapted to loading in hook system and
tankers with drinking troughs for animals.
Stoisko: D 293
MEPU Oy
Mynämäentie 59, 21900 Yläne
Dariusz Beńke
Area Manager of Polish Market
Meritum Bank ICB S.A.
Centrum Usług Finansowych w Poznaniu
ul. Hetmańska 91
60-218 Poznań
tel.: 801 980 888 – dla połączeń
z telefonów stacjonarnych,
+48 58 77 88 888, +48 58 88 80 888
– dla połączeń z telefonów komórkowych i z zagranicy.
www.meritumbank.pl
Meritum Bank kieruje swoją ofertę do klientów indywidualnych oraz osób prowadzących indywidualną działalność
gospodarczą i działalność rolniczą. Do najmocniejszej strony
oferty Banku należy Biznes Pożyczka dla mikro-przedsiębiorców. Ponadto oferujemy pełen zakres produktów kredytowych, w tym popularne kredyty gotówkowe, konsolidacyjne i
karty kredytowe. Zapraszamy do skorzystania z naszej oferty!
Stoisko: E 582
Merlo Polska Sp. z o.o.
ul. Warszawska 109
05-092 Łomianki
Biuro: +48 22 751 20 22
e-mail: [email protected]
www.merlo.com
Merlo posiada doskonałą światową pozycję na rynku
ładowarek teleskopowych, przede wszystkim dzięki jakości
i innowacyjności technicznej charakteryzującej maszyny
precyzyjne dla rolnictwa. Turbofarmer to gama najwydajniejszych ładowarek, pracujących w najbardziej ograniczonych miejscach, dzięki swoim małym wymiarom, łatwości
obsługi i doskonałej mocy. Multifarmer to prawdziwa
73
Spis wystawców
List of exhibitors
unikatowa rewolucja w ładowarkach rolniczych: pierwszy
wysięgnik rolniczy wyposażony w ramię teleskopowe,
trójpunktowy układ zawieszenia z tyłu i mechaniczny WOM
wysokich mocy.
Merlo has a worldwide position of excellence in the telescopic
handler market, mainly thanks to the quality and technical
innovation which qualify the machines for agriculture, industry
and construction. Turbofarmer are the most efficient handlers
in even the most restricted spaces, thanks to their compact
dimensions, ease of handling and excellent power levels.
Multifarmer is a true revolution in farm handling, the first farm
handler with telescopic boom, rear three – point linkage and a
high power mechanical PTO.
Stoisko: F 311
MESCOMP Opryskiwacze i części do modernizacji
opryskiwaczy
ul. Łąkowa 4a
64-000 Kościan
tel.: +48 65 614 14 14
tel./fax: 65 512 16 94
kom.: +48 601 58 00 11
e-mail: [email protected]
www.mescomp.com
Jesteśmy producentem opryskiwaczy rolniczych CHWAT
i HARDY o szerokości 18-36 m i pojemności zbiorników
2800-5500 l. Jeżeli szukacie Państwo wysokiej jakości
opryskiwaczy zachodnich zachęcamy do zapoznania się z
opryskiwaczami Mescomp – pierwszymi polskimi maszynami
klasy PREMIUM. Oferujemy też: najlepszy w testach PIMR i
Rolniczego Przeglądu Technicznego komputer do opryskiwaczy S411 z programowaniem dawki, miernik start ziarna do
kombajnów, nawigacje GPS, mierniki wilgotności zbóż Farmcomp, a do modernizacji opryskiwaczy: włoskie rozdzielacze
stałociśnieniowe, filtry, pompy Bertolini ze stali kwasoodpornej, rozpylacze Hypro, Albuz i TeeJet.
Mescomp Company is the producer of S411 computer for the
spraying machine and the world novelty S111 modern digital
grain loss monitor for harvesting machines. We are interested
in collaboration with agricultural manufacturers who need
computers to their machines.
Stoisko: C 194
Metalerg Sp. z o.o. S.K.A.
ul. Portowa 1a
55-200 Oława
tel.: +48 71 313 46 43
fax: +48 71 313 49 90
e-mail: [email protected]
www.metalerg.pl
Metalerg jest producentem kotłów opalanych słomą i inną
biomasą. Kotły te mogą służyć do ogrzewania domów,
jak również chlewni, szklarni, kurniki, suszarni oraz szkół
i całych osiedli mieszkaniowych na terenach wiejskich.
74
Produkujemy również nagrzewnice powietrza na słomę z
przeznaczeniem do suszarni zbóż i kukurydzy, zastępujące w
100% olej opałowy.
Metalerg is the manufacturer of boilers burned with straw and
other biomass. The boilers can be used to heat houses, greenhouses, piggeries, poultry houses, driers as well as schools
and whole housing estates in rural territories. NOVELTY! Air
heaters burned with straw for grain (especially maize) driers
which replace in 100% oil heaters.
Stoisko: D 564
Metal Fach Sp. z o.o.
ul. Kresowa 62
16-100 Sokółka
tel.: +48 85 711 98 44
fax: +48 85 711 07 89
e-mail: [email protected]
www.metalfach.com.pl
Stoisko: D 292
Metalinvest Sp. z o.o.
ul. Rybacka 2
78-630 Człopa
tel.: +48 67 387 21 40
Zakład nr 1
ul. Kołobrzeska 33
78-600 Wałcz
tel./fax: +48 67 259 14 73
Firma Metalinvest powstała w 2012r. z inicjatywy osób reprezentujących firmy działające w branży producentów konstrukcji
stalowych oraz maszyn i urządzeń rolniczych, z wieloletnim
doświadczeniem w prowadzeniu i rozwijaniu działalności.
Celem powstania spółki było rozpoczęcie i rozwój produkcji
elementów konstrukcji stalowych na zasadzie podwykonawstwa dla firm regionalnych, krajowych i zagranicznych branży
producentów zróżnicowanych elementów konstrukcyjnych ze
stali, w tym producentów maszyn, przyczep i naczep, konstrukcji budowlanych, itp. Aby zrealizować stawiane cele konieczne
było pozyskanie nieruchomości niezbędnych do posadowienia
maszyn i urządzeń do obróbki stali oraz optymalnego zorganizowania produkcji. Firma Metalinvest aby dorównać ciągle
rosnącym standardom stawia na nowoczesne rozwiązania
produkcyjne i aby to osiągnąć swój park maszynowy oparła o
nowe maszyny i urządzenia pozwalającym spełnić najwyższe
parametry jakościowe i wydajnościowe. W 2013 r. firma
bazując na doświadczeniu stworzyła swoją gamę produktów,
w naszej ofercie znajdują się m.in: preskontener na śmieci:
kontenery ciągnikowe (zwykłe i hydrauliczne): łyżki do piachu:
widły do oborników: opryskiwacze polowe: brony łąkowe:
nośniki do bel
Stoisko: C 206
M
e-mail: [email protected]
www.miary-wagi.com.pl
Z.M. METALTECH Sp. z.o.o. w Mirosławcu
ul. Orla 6
78-650 Mirosławiec
tel.: +48 67 259 51 76; 259 51 12
fax: +48 67 259 50 35
e-mail: [email protected]
www.metaltech.com.pl
Długa rodzinna tradycja wagarska przekuta w nowoczesne
systemy elektroniczne. Od roku 2003 podstawowym i dominującym profilem działania firmy jest produkcja i sprzedaż
elektronicznych wag samochodowych. W rolnictwie proponujemy wagi samochodowe, przenośne i stacjonarne oraz wagi
podkładkowe. W ofercie również wagi pod zbiorniki, wagi do
paszowozów oraz wagi do inwentarza.
Zakład Mechaniczny METALTECH Sp. z o.o. w Mirosławcu
zatrudnia 250 osoby. Firma zajmuje się produkcją przyczep
rolniczych i przyczep wolnobieżnych z przeznaczeniem do
branży komunalnej i budowlanej. Flagowym produktem są
przyczepy o oznaczeniach DB, PP, TB, TS, PH, PBN. Ładowność przyczep 4.5-30T. Objętość towaru 6-31m3.
Our company ZM METALTECH Ltd. placed in Mirosławiec
is employing 250 workers. Our production includes mainly
agricultural trailers but we also poduce universal hooklift
trailers, vertical mix wagons, building trailers and many other.
Technical carrying capacity ranges from 4 to 30 tons. And
volume capacity ranges from 6-31m3.
Stoisko: C 276
Metal-Technik s.c.
18-400 Łomża
ul. Nowogrodzka 58
tel.: 662 004 976 / 722 107 202
www.metal-technik.com
Firma Metal-Technik s.c. z Łomży istnieje od 2001 roku,
jest dynamicznie rozwijającym się producentem sprzętu
rolniczego na rynek krajowy i zagraniczny. Produkujemy
osprzęt do ładowaczy, ładowarek, mini ładowarek oraz sprzęt
komunalny - pługi i zamiatarki. Absolutnym hitem są włóki i
ładowacze, które pasują do większości ciągników. Posiadamy
sieć dilerów w całej.
The company Metal-Technik s.c of Łomża was established
in 2001, is a rapidly growing manufacturer of agricultural
equipment in domestic and foreign markets. We produce
equipment for Front loaders, Telescopic loaders, Mini loaders
and municipal equipment - Plows and Sweepers. The big
hit is a Meadow regenerator and the Front loaders that fits
most tractors. Also We have an important network of dealers
throughout the country.
Miary i Wagi company provides a wide range of electronic
scales, agricultural measurement solutions with load
cells, sensors and professional software. We are proud to
present wide range of weighbridge design types, including
pit mounted, surface mounted with ramps and portable
truck scales.
Stoisko: E 443
Przedsiębiorstwo Produkcyjno Handlowo Usługowe
MICHALAK
Leszczynek 48a
99-300 Kutno
tel./fax: +48-24-254-74-05
kom: +48-501-763-808
e-mail: [email protected]
www.agromichalak.pl
Produkcja maszyn rolniczych: agregaty uprawowe, wały uprawowe, brony łąkowo-polowe, kolczatki, podajniki ślimakowe,
głębosze, pługi odśnieżne, betoniarki ciągnikowe, zamiatarki,
chwytaki.
Production of agricultural machines: cultivating units, roll
rings, meadow and field harrows, rotary harrows, worm
feeders, subsoilers, snowploughs, tractor concrete mixers,
sweeps, grabs.
Stoisko: A 10
Michał Z.P.U.H. Krzysztof Targoński
ul. 1 Maja 7c
18-200 Wysokie Mazowieckie
tel.: +48 86 275 90 80
fax: +48 86 275 90 81
e-mail: [email protected]
www.michal-silosy.pl
Stoisko: D 423
Stoisko: D 287
MIARY I WAGI SP.J.
ul. Smaków 9
49-318 Skarbimierz Osiedle
tel.: +48 77 411 39 28
fax: +48 77 544 93 77
Międzynarodowe Targi Poznańskie Sp. z o.o.
ul. Głogowska 14
60-734 Poznań
tel.: +48 61 869 20 00
fax: +48 61 869 29 99
e-mail: [email protected]
www.mtp.pl
Stoisko: D 91
75
Spis wystawców
List of exhibitors
MILTOM- EKO Sp. z o.o.
ul. Boya-Żeleńskiego 4/6
00-621 Warszawa
tel.: +48 22 825 05 10
fax: +48 22 825 14 12
e-mail: [email protected]
www.miltomeko.pl
MMAT Marian Mikołajczak Agro Technology
Gronówko 23A k/Leszna
64-111 Lipno
tel/fax: +48 65 527 15 20
tel.: +48 607 442 259
e-mail: [email protected]
www.mmat.pl
Miltom-Eko oferuje kompleksową realizację inwestycji od
projektu do budowy. Posiadamy systemy zbiorników dla:
rolnictwa, przemysłu i ochrony środowiska; oczyszczalni
ścieków; SUW; biogazowi; instalacji ppoż.; wraz z niezbędnym
wyposażeniem m.in.: ujęcia biogazu, mieszadła i pompownie,
niezbędny osprzęt i armaturę. Swoim klientom oferujemy
również technologię cyklicznego oczyszczania ścieków C-tech.
Miltom-Eko provides a comprehensive implementation of
investment from design to construction. We have systems of
the tanks for: agriculture, industry and environmental protection; sewage treatment and water purification plant; installation
of biogas and fire protection with necessary equipment. We
offer also cyclic activated sludge technology C-tech.
Stoisko: C 202
Ministerstwo Rolnictwa i Rozwoju Wsi
ul. Wspólna 30
00-930 Warszawa
tel.: +48 22 623 10 00
fax: +48 22 623 27 50
e-mail: [email protected]
www.minrol.gov.pl
Firma MMAT Marian Mikołajczak Agro Technology, jest wiodącym,polskim producentem rozpylaczy płaskostrumieniowych.
Zdobyta wiedza i doświadczenie oraz sposób wytwarzania, przełożyły się na wysoką jakość naszych produktów, dzięki której
nasze rozpylacze zyskały uznanie wśród rolników i otrzymały
pozytywne opinie od polskich i zagranicznych instytutów badawczych w tym niemieckiego Julius Kuhn Institut (wcześniej BBA).
Zapraszamy do współpracy i zapoznania się z naszą ofertą.
MMAT Company, Marian Mikołajczak Agro Technology, is a
leading, Polish producer of flat-stream-oriented sprayers for
farming. Gained over years, the knowledge and experience
and the way of producing, transferred into high quality of
our products, thanks to which our sprayers are commended
among farmers and received positive opinions from Polish
and foreign research institutes including German Julius Kuhn
Institute (formerly BBA). We offer you the following types of
sprayers: STANDARD FLAT SPRAY NOZZLES, ANTI-DRIFT
NOZZLES, AIR-INJECTOR COMPACT NOZZLES, TWIN FLAT
SPRAY AIR-INJECTOR COMPACT NOZZLES. We invite to
cooperation and detailed acquainting with our offer.
Stoisko: C 62
Na stoisku Ministerstwa Rolnictwa i Rozwoju Wsi można
uzyskać informacje dotyczące m.in.: unijnych funduszy na
rozwój rolnictwa, obszarów wiejskich, agroturystyki, rolnictwa
ekologicznego, produktów regionalnych i tradycyjnych oraz
możliwości inwestowania w przemysł rolno-spożywczy.
The stand of the Ministry of Agriculture and Rural Development provides information about the programs of the rural
development, agritourism, organic agriculture, possibility of
registration, protection and promotion of regional products,
and investing in food sector.
Moskit PPHU
Śliwnik, ul. Skalmierzycka 52
63-460 Nowe Skalmierzyce
tel.: +48 62 762 10 40
fax: +48 62 762 10 40
e-mail:[email protected]
www.moskit.net.pl
Stoisko: C 193
Moto-Bus Wątroba, Andrearczyk Sp. j.
ul. Nakielska
85-350 Bydgoszcz
tel.: +48 52 379 80 01
fax: +48 52 379 82 58
Stoisko: F 139
Stoisko: C 396
Mirol Zakład Handlowo-Usługowy Mieczysław Michalski
Stary Kamień
82-550 Probuty
tel.: +48 55 278 20 37
fax: +48 55 278 20 37
e-mail: [email protected]
[email protected]
Stoisko: A 263
M-ROL Sp. z o.o. Sp. k.
ul. Strzelecka 45B
63-430 Odolanów
tel./fax: +48 62 733 15 75
e-mail: [email protected]
www.mrol.eu
Proponujemy Państwu zakup urządzeń do przygotowania kar-
76
N
my dla zwierząt, transportu zboża oraz maszyny do suszenia
ziarna. Zakład nasz produkuje dla rolników już od 1974 roku
wypracowując przez te lata doświadczenie i zaufanie klientów
do naszej firmy. Zapraszamy do naszego działu handlowego.
Stoisko: C 390
MS-Agrotech
Kleczew, ul. Kościuszki 19
Konin, Ślesin
kom.: +48 662 103 533
e-mail [email protected]
www.ms-agrotech.pl
Firma MS-AGROTECH Sp. z o.o. jest firmą rodzinną prężnie
działająca na rynkach zachodnich. Zdobyte tam doświadczenie i umiejętności chcemy obecnie wykorzystać na rynku
polskim. W naszej ofercie podążamy za najnowszymi trendami, zachowując jednocześnie technologie które doskonale
sprawdzały się do tej pory. Specjalizujemy się w :
montażu źródeł energii odnawialnej; montażu instalacji
wodnych; wyposażaniu budynków inwentarskich w ciągi
technologiczne; wykonywaniu i produkcji systemów wentylacyjnych; wykonywaniu instalacji elektrycznych w budynkach
przemysłowych i inwentarskich; produkcji elementów pojenia
zwierząt; sprzedaży elementów wyposażenia budynków
inwentarskich oraz silosów.
Oferujemy SIEWNIKI do warzyw MONOSEM, KOMBAJNY do zbioru warzyw ASA-LIFT, kombajny do zbioru
pomidorów Guaresi. Posiadamy w ofercie LINIE EKKO DO
OBRÓBKI WARZYW ORAZ ZIEMNIAKA bunkry, odziemiacze, sor towniki, myjki, polerki. Automatyczne ZESTAWY DO WAŻENIA I PAKOWANIA OWOCÓW, WARZYW.
SORTOWNIE OWOCÓW ELISAM Wielokanałowe wagi
komputerowe, urządzenia do delikatnego pakowania
w worki foliowe, siatkę, styropian, punnety. Systemy
paletyzacji Proponujemy OPAKOWANIA – folia, siatka,
raszel, ver tbag, punnety Zapewniamy serwis oraz części
zamienne.
Stoisko: F 252
NDS Grzegorz Michałek
ul. Bukowska 4, Dakowy Suche
64-320 Buk
tel.: +48 61 814 03 98
fax: +48 61 894 79 52
kom.: + 48 607 054 090
e-mai: [email protected]
skype: nds_nawadnianie
www.nawadnianie.com
Stoisko: C 389
Specjalizujemy się w sprzedaży kompletnych systemów
nawadniających oraz sprzętu do zagospodarowania gnojowicy, zapewniając przy tym fachowe doradztwo oraz projekty
techniczne. W swojej ofercie handlowej posiadamy również
siewniki, sadzarki, glebogryzarki, pielniki międzyrzędowe,
opryskiwacze polowe i sadownicze oraz silosy paszowe.
Obsługujemy cały przekrój gospodarstw wraz z możliwością
finansowania maszyn.
MURATOR S.A.
ul. Dęblińska 6,
04-187 Warszawa
tel.: +48 22 590 50 00
fax: +48 22 590 54 44
e-mail: [email protected]
www.wydawnictwo.murator.pl
MURATOR S.A. – jeden największych polskich wydawców,
lider wśród wydawnictw branżowych. Wydajemy czasopisma
o tematyce budowlanej, wnętrzarskiej, a także podróżniczej i
żeglarskiej. Do wydawnictwa należy dziennik „Super Express”
oraz kilkadziesiąt portali i projektów internetowych. W ofercie
Muratora znajduje się ponadto największa w Polsce Kolekcja
ponad 1300 projektów gotowych, wśród nich: domy, garaże,
budynki garażowo - magazynowe, magazyny, budynki
inwentarskie (obory, chlewnie, tuczarnie, kurniki, stajnie) oraz
budynki usługowe (sklepy, punkty gastronomiczne, pensjonaty, zajazdy, budynki agroturystyczne, przedszkola, inne). Realizujemy także projekty na indywidualne zamówienie Klienta.
Pełna oferta w Katalogach „ Murator Projekty Domów” oraz
„Budynki dla Rolnictwa” oraz na stronie www.projekty.murator.pl. Zapraszamy na stoisko C 381 po bezpłatne katalogi.
Stoisko: C 381
FH Najbar
ul. Bandurskiego 22
31-515 Kraków
tel.: +48 12 411 59 59
www.najbar.com.pl
We specialize in the sales of complete watering systems and
liquid manure management systems, providing expert advice
and technical designs. We also offer seeders, planters, soil
millers, drill hoes, field and garden spraying machines, and
feed silos. We supply all types of farms and offer the possibility of financing the machines.
Stoisko: B 177
NEOROL Sp. z o.o.
63-210 Żerków
ul. Akacjowa 1, Chrzan
tel.: +48 62 740 36 37
fax: +48 62 740 30 38
e-mail: [email protected]
www.neorol.com.pl
NEOROL Sp. z o.o. to jedna z najdynamiczniej rozwijających
się firm paszowych w Polsce. Produkujemy pasze, koncentraty, premiksy dla trzody chlewnej, bydła i drobiu. Zapewniamy
fachowe doradztwo i serwis żywieniowy.
77
Spis wystawców
List of exhibitors
NEOROL Sp. z o.o. is one of most dynamically developing
fodder producing companies in Polen. We produce various
types of fodder, concentrates, premixes for swine, cattle
and poultry. We ensure professional consulting and feeding
service.
Stoisko: B 346
NEUERO Farm- und Fördertechnik GmbH
Alter Handelsweg 11
D 49328 Melle
Niemcy
tel.: +49(0)5427 9270-0
Tel. +48 664 786 986
e-mail: [email protected]
www.neuero-farm.pl
Producent technologii dla przechowalnictwa, transportu materiałów sypkich, suszarni, oczyszczalni oraz mielenia ziaren i
materiałów sypkich w rolnictwie oraz przemyśle.
Hersteller von Technologien zur Lagerung, Förderung, Trocknung, Reinigung und Vermahlung von Körnerfrüchten und
Schüttgütern für die Landwirtschaft und Industrie.
Stoisko: hala 28
New Holland
CNH Polska
09-407 Płock
ul. Otolińska 25
tel.: +48 24 267 97 00
www.newholland.pl
NT Industry Sp. z o. o.
ul. Fabryczna 1
43-180 Orzesze
tel.: +48 32 326 36 65
fax: +48 32 326 36 67
e-mail: [email protected]
www.ntagro.com
www.ntagro.pl
www.ntindustry.com
Od lat jesteśmy wiodącym producentem przyczep rolniczych.
Swoje produkty dostarczamy głównie na rynki skandynawskie. Od 2010 roku tworzymy jedną grupę kapitałowa z duńską firmą Baastrup. Ekspansja na rynek polski oraz inne rynki
europejskie jest naszym kolejnym krokiem w celu umocnienia
pozycji lidera pośród pozostałych producentów przyczep
rolniczych. Gama naszych produktów wciąż się poszerza.
Produkujemy przyczepy o tonażu od 10 do 21ton w różnych
konfiguracjach, z uwzględnieniem przyczep budowlanych.
For years, we are the leading manufacturer of agricultural
trailers. Our products are delivered mainly on the Scandinavian
markets. Since 2010 we have been creating one company
together with Danish company Baastrup. The expansion into
Polish market and other markets in Europe is our next step in
order to strengthen the leading position among the other manufacturers of agricultural trailers. Our product range is constantly
expanding. We manufacture trailers with tonnage from 10 to
21ton in various configurations, including the civil trailers.
Stoisko: F 257
Stoisko: C 282
Nijhuis Water Polska Sp. z.o.o.
ul. Sułkowskiego 15
05-820 Piastów
tel.: +48 22 723 54 30
fax: +48 22 753 82 66
www.nijhuis-water.pl
Kompleksowe usługi w zakresie biogazowni rolniczych dla odpadów zwierzęcych i roślinnych: doradztwo technologiczne,
pomoc w pozyskiwaniu finansowania, obsługa projektowa,
dostawy urządzeń, realizacja „pod klucz”, serwis. Oferujemy
rozwiązania dostoswane do potrzeb odbiorców o szerokim
zalaesie wydajności i mocy. 23 lata pracy na polskim rynku,
120 instalacji ściekowo-odpadowych oraz kilkaset inwestycji
w Europie, w tym ponad 25 biogazownii.
Stoisko: E 584
Oil Center Sp. z o.o. Sp. k.
ul. Domaniewska 47
02-672 Warszawa
tel.: +48 22 349 22 34
fax: +48 71 327 30 65
e-mail: [email protected]
www.oilcenter.pl
Zajmujemy się dystrybucją najwyższej jakości olejów i smarów dedykowanych do nowoczesnych maszyn rolniczych:
John Deere, Case IH, New Holland, Caterpillar, Ford, Kubota,
Denison, Landini, Same Deutz-Fahr Group, Claas, Sampo
Rosenlew, AGCO Group: Massey Ferguson, Fendt i wiele innych. Oferujemy szeroką gamę produktów, atrakcyjne warunki
współpracy i dostawę do każdego miejsca w Polsce w 24 h!
Oil Center provides only high quality oils and lubricants
dedicated to modern agricultural machinery: John Deere, Case
IH, New Holland, Caterpillar, Ford, Kubota, Denison, Landini,
Same Deutz-Fahr Group, Claas, Sampo Rosenlew, AGCO
Group: Massey Ferguson, Fendt and many others.
We offer a wide range of products, attractive terms for our
clients and delivery within 24 hours!.
Stoisko: D 107
78
O
OPaLL-AGRI, s.r.o.
Hertice 7
747 55 Dolni Zivotice
Czechy
tel.: +420 553 786 165
fax: +420 553 786 120
e-mail: [email protected]
www.opall-agri.cz
OKNA AMATI
Rzeczków 32
97-319 Będków
tel.: 44 6168757
kom.: 604096414
e-mail: [email protected]
www.amati.com.pl
Stoisko: B 25
OKNA AMATI istnieje nieprzerwanie od 2001r. Nasza firma
zajmuje się produkcją i sprzedażą okien pcv, drzwi pcv i okien
gospodarczych. W ofercie posiadamy również parapety wewnętrzne i zewnętrzne, moskitiery, rolety materiałowe, plisy.
Odwiedź naszą stronę internetową aby dokładnie zapoznać się
z ofertą, skontaktuj się z nami telefonicznie w celu otrzymania
darmowej wyceny, napisz do nas maila a oddzwonimy.
WINDOWS AMATI there continuously since 2001. Our company
is engaged in production and sale of PVC windows, PVC doors
and windows business. We also offer interior and exterior window sills, mosquito nets, blinds fabric, pleats. Visit our website
to read carefully the offer, please contact us by phone to obtain a
free quote, please email us a call back.
Stoisko: D 544
Omarv srl
Via Cuneo 60
12038 Savigliano
Włochy
tel.: +390172715114
fax: +390172780028
[email protected]
www.omarv.com
ORLEN GAZ Sp. z o.o.
ul. Zglenickiego 46a
09-411 Płock
Centrum Obsługi Klienta 801 100 100
e-mail: [email protected]
www.orlengaz.pl
ORLEN GAZ jest największym polskim dystrybutorem gazu
płynnego. Doświadczeni eksperci ORLEN GAZ oferują skrojone na miarę rozwiązania w zakresie instalacji dla przemysłu
i rolnictwa, w tym ferm drobiu, ubojni oraz suszarni. ORLEN
GAZ gwarantuje bezpieczeństwo dostaw, najwyższą jakość
gazu oraz profesjonalne doradztwo na każdym etapie prowadzenia inwestycji.
ORLEN GAZ is the largest Polish distributor of the liquid gas.
Experienced ORLEN GAZ experts offer customised solutions
for systems for industry and agriculture, including poultry
farms, abattoirs and dryers. ORLEN GAZ guarantees safety of
deliveries, the highest quality of gas and professional counselling at each investment stage.
Stoisko: C 385
Stoisko: E446
Omnivent Sp. z o.o.
ul. Sępoleńska 20
77-420 Lipka
tel.: +48 67 266 54 02
fax: +48 67 266 54 03
e-mail: [email protected]
www.omnivent.pl
OSI POLAND FOODWORKS
tel.: +48 603 043 546, 605 726 898,
605 176 898, 696 988 393
e-mail: [email protected]
www.foodworks.pl
Omnivent jest światowej klasy specjalistą w zakresie projektowania, produkcji i montażu najwyższej jakości systemów
przechowywania ziemniaków, cebuli, marchwi i innych płodów
rolnych. Omnivent jest na czele rynku w rozwoju trwałych i
niezawodnych urządzeń. Nasi klienci mogą mieć pewność, że
mają najbardziej wiarygodny i energooszczędny sprzęt oraz
fachową pomoc, co zapewni minimalne straty jakości.
OSI POLAND FOODWORKS jest jednym z największych zakładów uboju bydła rzeźnego w Polsce. Należy do amerykańskiego koncernu OSI GROUP. Posiadamy trzy bazy skupowe: woj.
wielkopolskim, kujawsko-pomorskim i warmińsko-mazurskim.
Oferujemy światowe standardy obsługi, rzetelne rozliczenia,
pewne płatności i system kontraktacji pozwalający na stabilny
rozwój hodowli bydła oraz oferowanie wyższych cen w skupie!
Omnivent is the worldwide active specialist in design, production
and installation of state-of-the-art storage technology for potatoes,
onions, carrots and other crops. Omnivent is ahead the market in
the development of reliable equipment. For this reason you can
be sure that you will have the most reliable and energy efficient
equipment with minimal quality losses and an optimal support.
OSI POLAND FOODWORKS is one of the biggest slaughterhouses for cattle in Poland. It belongs to an American concern,
the OSI Group. We own three purchase bases in the districts of
Wielkopolska, Kujavia-Pomerania and Warmia-Mazury. We offer
international service standards, accurate settlements, reliable
payments and a contracting system that allows a continuous development of cattle breeding and offering higher purchase prices.
Stoisko: C 524
Stoisko: F 478
79
Spis wystawców
List of exhibitors
niu oraz serwisowaniu urządzeń do czyszczenia ziarna, materiału siewnego, nasion wszystkich gatunków zbóż, rzepaku,
kukurydzy, nasion roślin strączkowych i innych. Działalność
firmy „PAT” można ująć w trzech słowach: innowacyjność,
niezawodność, skuteczność.
otoMoto.pl
ul. Grunwaldzka 182
60-166 Poznań
e-mail: [email protected]
tel.: +48 61 630 60 06
Szybko sprzedaj i kup maszynę rolniczą na www.otomoto.
pl! U nas znajdziesz 20 tyś ogłoszeń dotyczących specjalistycznych ciągników, kombajnów, maszyn uprawowych i
siewnych, przyczep i wielu innych. otoMoto.pl to największy
serwis ogłoszeń motoryzacyjnych w Polsce! Ponad 350 000
ogłoszeń i ponad 9 mln potencjalnych Klientów!
PAT Chomutow sp.j. general partnership was established in
Poland in 1992. We specialise in producing, setting up and
servicing grain cleaning machines designed for a wide range
of applications such as seed grain cleaning, cleaning of
cereals, rapeseed, corn, pulses etc.
Stoisko: D 425
Stoisko: B 186
P.H.U. TRANS Piotr Stachowiak
ul. M. Konopnickiej 61/52
85-124 Bydgoszcz
kom.: +48 603 677 553
Stoisko: E 587
PARTNER Systems Sp. z o.o.
ul. Jerzego z Dąbrowy 5d
77-300 Człuchów
tel.: +48 59 834 44 88
tel./fax: +48 59 834 56 05
kom.: +48 668 513 853
email: [email protected]
Pedrotti Polska Sp. z o.o.
Stolec 1A
57-200 Ząbkowice Śląskie
tel.: +48-74-817-36-03
fax: +48-74-817-36-91
e-mail: [email protected]
www.pedrotti.pl
PEDROTTI POLSKA Sp. z o.o. - wyłączny dystrybutor
włoskich przewoźnych suszarni Pedrotti do zbóż, rzepaku i
kukurydzy na obszarze Polski. Suszarnie Pedrotti - energooszczędne i niezawodne w każdych warunkach. Szeroki wybór
modeli o wydajnościach od 30 do 380 ton/dobę. Sprzedaż,
wynajem, serwis.
Produkcja: pługi do odśnieżania, piaskarko-solarki, zamiatarki
i inne. Zbiorniki PetroPartner na ON (także mobilne) o poj. Od
999-2500 L, do przechowywania i dystrybucji ON w każdych
warunkach. NOWOŚĆ! WATER TANK PARTNER – mobilny zbiornik na wodę. Perfekcyjny do dystrybucji i zaopatrzenia w wodę
wszędzie i w każdych warunkach: powodzie, huragany, awaria
sieci wodociągowych. Więcej na: www.partnersystems.pl
Manufacture of snow ploughs, gritting and road sweaping
equipment. Petro Partner diesel tanks with 999-2500l capacity
for storage an distribiution of diesel in alll conditions. NEW!
Water Tanks Partner – mobile plastic water tank with from
1000L capacity. Perfect for distribiution and supply of water in
all conditions: floods, hurracains, water mains system failure.
More on: www.partnersystems.pl
PEDROTTI POLSKA Sp. z o.o. – sole distributor in Poland
of Italian Pedrotti mobile grain, rape and maize dryers. The
Pedrotti dryers- energy saving and reliable in all conditions.
Wide range of models of capacity from 30 to 380 tonnes/24
hrs. Sales, rent, servicing.
Stoisko: D 417
Pellon Sp. z o.o.
ul. Mickiewicza 45
96-300 Żyrardów
tel./fax: +48 46 855 02 44
e-mail: [email protected]
www.pellon.pl
Stoisko: F 484
Stoisko: D 86
„PAT” Chomutow Sp. j.
Zebrzydów 1
58-124 Marcinowice
tel./fax: +48 74 85 85 106 wew. 318
tel.: +48 605 305 842
e-mail: [email protected]
www.wialnia.pl
Firma „PAT” Chomutow sp. j. na Polskim rynku istnieje od
1992 r. Specjalizujemy się w produkcji, montażu, uruchamia-
80
PHU Perkoz Sp z o.o.
ul. Sikorskiego 19a
87-300 Brodnica
tel.: +48 56 49 34 057
fax: +48 56 49 83 234
e-mail: [email protected]
www.perkoz.com.pl
Perkoz - wyłączny importer: wozów paszowych Seko. Dealer
maszyn rolniczych: New Holland, Kverneland,Unia Group,
Joskin, Väderstad. Zapewniamy profesjonalny serwis, części
zamienne do wszystkich oferowanych maszyn oraz dogodne
warunki zakupu.
P
Perkoz - exclusive importer: mixer wagons Seko. Dealer
of agricultural machinery: New Holland, Kverneland, Unia
Group, Joskin, Väderstad. We provide professional service,
spare parts for all of their machines and easy conditions of
purchase.
tajwańskiej stosowanych w rolnictwie, transporcie wewnętrznym, maszynach roboczych. Wyroby te charakteryzują się
jakością na poziomie wiodących marek za nieporównywalnie
niższą cenę. Służymy Państwu 20 – letnim doświadczeniem
i zapraszamy!
Stoisko: B 184
Peter Gröger GMBH
Bloge 4
49429 Rechterfeld
Niemcy
tel.: +49 444 596 3666
fax: +49 444 596 3660
e-mail: [email protected]
www.agroliner.de
Stoisko: E 238
Petroconsulting Sp. z o.o.
ul. Makowa 16
86-300 Grudziądz
tel./fax: +48 56 462 26 22
e-mail: [email protected]
www.petroconsulting.pl
Stoisko: E114
pewag polska Sp. z o.o.
ul. Bielska 1124
43-374 Buczkowice
tel.: +48 33 810 45 55
fax: +48 33 810 46 66
e-mail: [email protected]
www.pewag.pl
Stoisko: hala 35
PIAST PASZE Sp. z o.o.
Lewkowiec 50A
63-400 Ostrów Wlkp.
tel.: +48 62 763 234
fax: +48 62 735 99 01
e-mail: [email protected]
Wytwórnia Pasz PIAST II
09-100 Płońsk
ul. Mazowiecka 4
tel.: 23 6613480
fax: 23 6624720
e-mail: [email protected]
Wytwórnia Pasz Piast Sp. z o.o.
62-130 Gołańcz
ul. Smolary 40
tel.: 67 2615116
fax: +48 67 261 16 29
e-mail: [email protected]
Stoisko: B 340
Firma pewag to austriacki producent łańcuchów ogniwowych
oferujący: łańcuchy śniegowe na koła wszystkich pojazdów,
łańcuchy zrywkowe do prac leśnych, odciągi łańcuchowe do
mocowania, ładunków w transporcie, zawiesia łańcuchowe
stosowane w technice dźwigowej, łańcuchy nierdzewne do
pomp zanurzeniowych. Na tragach Agro Show firma pewag
prezentuje łańcuchy antypoślizgowe na koła traktorów.
pewag is Austrian chain manufacturer which produces: snow
chain for all kind of vehicles, forestry chocker chains, lashing
chains for load securing, sling chains, stainless steel chains
for submerged pumps. pewag presents snow chains for
tractors on Agro Show.
Stoisko: E 113
PHU UNI-TRADE EXPORT-IMPORT
ul. Wiadukt 5
09-400 Płock
e-mail: [email protected]
www.uni-trade.eu
Jesteśmy dystrybutorem łożysk tocznych adresowanych do
rolnictwa i przemysłu maszynowego pod znanymi markami:
DKF01, DKF05, DKF06 (Germany licence) i SPZ (Russia).
Dostawy realizujemy z magazynu w Płocku, gdzie składujemy
stale ok. 5 mln sztuk, co gwarantuje możliwość realizacji zamówień „od ręki”. Jesteśmy dostawcą opon i dętek produkcji
PICHON S.A.
Z.I. de Lavallot
29490 Guipavas, Francja
tel.: +33 29 834 41 00
fax: +33 29 834 41 20
Kontakt na terenie Polski
kom.: +48-506-282-653
e-mail: [email protected]
www.pichon.pl
Stoisko: B 183
PIG-SIN
Import-Export
ul. F. Marciniaka 43
63-500 Ostrzeszów
tel.: +48 62 730 17 02
fax: +48 62 730 16 78
e-mail: [email protected]
PIG-SIN - kompleksowe wyposażanie budynków inwentarskich. Posiadamy duże doświadczenie w modernizacji
i projektowaniu chlewni bezściółkowych, obór i kurników.
Oferujemy: Ruszta betonowe i plastikowe MIK. Silosy i automaty paszowe. Wygrodzenia dla trzody i bydła. Paszociągi
spiralne i koralikowe. Systemy żywienia, pojenia, wentylacji,
ogrzewania podłogowego. Termoizolacja sufitów. Sprzęt
zootechniczny.
81
Spis wystawców
List of exhibitors
PGI-SIN - comprehensive equipping buildings for livestock.
We have extensive experience in the modernization and
designing piggeries, cowsheds and poultry farm. We offer:
Concrete slats and plastic slats MIK. Silos and automatic
feeders. Partitions for pigs and cattle. Spiral feeding lines
and chain. Systems of feeding, watering, ventilation, underfloor heating. Ceiling insulation. Equipment for livestock.
Stoisko: E 452
Firma działa na rynku od 1965 r. Specjalizuje się w produkcji
plandek na: samochody ciężarowe, maszyny rolnicze, wózki
widłowe, a także oferujemy plandeki okryciowe, plandeki na
biogazownie, worki kompensacyjne, kotary, namioty, membrany,
ogródki restauracyjne, bannery, zadruki wielkoformatowe i inne.
The company was established in 1965. We specialize in
production of: car tarpaulins for all type vehicle, covers for
machineries, windows and covers for forklift trucks, tarpaulins
for biogas plants, curtains walls, tents, membranes, beer gardens, banners, mega-format print. We also offer many more.
Stoisko: D 541
Vitli KRPAN d.o.o.
Jazbina 9/a
3240 Šmarje pri Jelšah
SŁOWENIA
tel.: +386/3/819/00/90
fax: +386/3/819/00/92
e-mail: [email protected]
www.vitli-krpan.com
Krpan wciągarki leśne: 36 lat doświadczenia w inżynierii.
Profesjonalna jakość maszyn leśnych. Różne patenty oraz
liczne nagrody podkreślają 36 lat doświadczenia w słoweńskiej produkcji wciągarek leśnych Krpan. Zakłady produkcyjne
zostały rozszerzone na powierzchni ponad 14,000m2. Zadaszenie obiektu składa się z 500 kW systemu fotowoltaicznego.
Rocznie produkujemy około 8.200 wciągarek leśnych, 2.000
łuparek hydraulicznych, 1.600 platform ciągnikowych, 400
chwytaków pni. Dodatkowo planujemy także rozwój nowego
sprzętu leśnego do etapu masowej produkcji. Nasza firma jest
najstarszym producentem wciągarek leśnych w Słowenii i największym w Europie. Dużą wagę przywiązujemy też, jakości
(3 lata Gwarancji) oraz bezpieczeństwu swoich produktów.
Krpan cable winches: 36 years of experience in engineering.
Professional quality forestry machinery. Various patents and
numerous awards underscore the 36 years of experience of the
Slovene cable winch manufacturer Krpan. The production facilities have been expanded to an area of more than 14,000m2.
The roofing of the facility consists of a 500kW photovoltaic
system. The annual production amounts to approximately
8.200 cable winches, 2.000 log splitters, 1.600 tractor plateaus, 400 wood grapple. Additionally, we are also planning the
development of new forestry equipment to the mass production
stage in the future. Our company is the oldest producer of
forest winches in Slovenia and the biggest in Europe. We attach
great importance to quality (3 years Warranty) and safety of
our products.
Stoisko: C 595
Planta Sp. z o.o.
ul. Kardynała Wyszyńskiego 16A
33-100 Tarnów
tel.: +48 14 6395 500
e-mail: [email protected]
www.planta.net.pl
Planta Sp. z o.o. jest jedną z największych firm w Polsce kompleksowo zaopatrującą hurtownie i sklepy ogrodnicze w pełny
asortyment produktów związanych z pracą i wypoczynkiem w
domu i ogrodzie. W ofercie firmy znajdziecie Państwo szeroką
gamę mieszanek traw, bogaty wybór nawozów ogrodniczych
płynnych, posypowych i wodorozpuszczalnych, narzędzia
ogrodnicze Khayner Garden oraz GardenMAX, szeoką gamę
opryskiwaczy ciśnieniowych, grille i akcesoria do grillowania,
doniczki plastikowe i ceramiczne, bogaty asortyment nasion
rolnych, ofertę agrowłóknim i agrotkanin, gamę pokarmów dla
ptaków i zwierząt domowych oraz wiele innych produktów.
Planta Sp. z o.o. is producer of lawn mixtures, liquid and
granulated fertilizers, soluble in water fertilizers, agricultural
seeds, nonwonen and nonfabric, pet food and wide range of
other products made for work and relaxation in your garden.
Stoisko: C 512
PlantiCo - Hodowla i Nasiennictwo
Ogrodnicze Zielonki Sp. z o.o.
ul. Parkowa 1A
05-082 Zielonki Parcele
tel.: +48 22 722 90 66
fax: +48 22 722 95 72
e-mail: [email protected]
www.plantico.pl
Stoisko: B 370
Plandeki Raszyn
Marcin Kowalski
Al. Krakowska 4
05-090 Raszyn
tel.: +48 22 727 94 94, 22 720 09 19
e-mail: [email protected], [email protected]
www.plandeki.pl
82
Plantpress Sp. z o.o.
ul. J. Lea 114a
30-133 Kraków
tel./fax: +48 12 636 18 51, 622-57-60, 638-28-64 (65)
e-mail: [email protected]
www.plantpress.pl
P
Wydawca czasopism ogólnopolskich i europejskiego magazynu sadowniczego oraz książek o tematyce ogrodniczej
„Hasło Ogrodnicze”, „MPS SAD”, „Informator Sadowniczy”,
„Warzywa”, „Szkółkarstwo”, „EFM European Fruitgrowers
Magazine”.
The publisher of the following magazines: „Hasło Ogrodnicze”, „MPS SAD”, „Warzywa”, „Szkółkarstwo”, „Informator
Sadowniczy”, „EFM European Fruitgrowers Magazine”, as
well as books on gardening
Stoisko: A 8, C 380
Platinum Oil Wielkopolskie Centrum Dystrybucji Sp. z o.o.
ul. Budowlanych 3-5, Baranowo
62-081 Przeźmierowo
tel.: +48 61 816 26 00
fax: +48 61 816 26 01
e-mail: [email protected]
www.platinumoil.eu
Oddziały:
ul. Koniawska 49D
66-400 Gorzów Wlkp.
tel./fax: +48 95 723 83
ul. Nowa 8
63-400 Ostrów Wlkp.
tel./fax: +48 62 735 50
ul. B. Chrobrego 121
87-100 Toruń
tel./fax: +48 56 657 21
ul. Działkowa 19
65-767 Zielona Góra
tel./fax: +48 68 320 38
40/41
Plottnik AgroConsulting
ul. Św. Ducha 120
63-200 Jarocin
tel./fax: +48 62 505 00 01
Rafał Iwan
Przedstawiciel handlowy
kom.: + 48 692 204 661
e-mail: [email protected]
Waldemar Plottnik
tel.: + 49 2545 919 313
tel.: + 49 16 095 979 711
e-mail: [email protected]
Plottnik Consulting zajmuje się od lat transferem nowoczesnej technologii dla i wokół rolnictwa. Analizujemy
potrzeby klienta na miejscu, szukamy najlepszych rozwiązań,
oferujemy sprawdzone, trwałe i tanie w eksploatacji technologie. Nasza główna kompetencja to obróbka zboża od
magazynowania, poprzez konserwację do przerobu na paszę
i jej skarmianie na fermie. Redukcja kosztów produkcji przez
zastosowanie najnowszej technologii to jedyna strategia dla
przedsiębiorców w rolnictwie, którzy chcą/muszą stawić się
globalnemu rynkowi.
Stoisko: C 404
01/02
12/13
20/21
Platinum Oil Wielkopolskie Centrum Dystrybucji Sp. z o.o.
zajmuje się sprzedażą olejów: silnikowych, przekładniowych,
hydraulicznych i przemysłowych produkcji Orlen Oil, a także
smarów, parafiny, płynów eksploatacyjnych i do chłodnic,
kosmetyków i akcesoriów samochodowych. Firma posiada
Zakład Produkcji Chemicznej, w którym odbywa się m.in.
konfekcja płynu PetrygoQ i MaxMaster oraz produkcja chemii
samochodowej. Wykwalifikowany personel zapewnia fachowe
doradztwo techniczne, szybką i sprawną obsługę, serwis oraz
dostawę pod wskazany przez klienta adres.
Platinum Oil Wielkopolskie Centrum Dystrybucji sells engine,
gear, hydraulic and industrial oils produces by Orlen Oil, as
well as lubricants, paraffin, operational fluids and coolants,
car cosmetics and accessories. The company owns the Chemical Production Plant, where, amongst the others, PetrygoQ
and MaxMaster coolants are packed and car chemicals produced. Our well-qualified staff provides professional technical
counseling, quick and efficient service, servicing and delivery
to the address given by a customer.
AIRPRESS
Pneumapol Jankowscy Sp.j.
ul. Rynkowa 156
62-081 Przeźmierowo k.Poznania
tel.: +48 61 652 57 00
e-mail: [email protected]
www.airpress.pl
Sprężarki śrubowe, sprężarki tłokowe, narzędzia pneumatyczne, narzędzia ręczne, podnośniki, oleje, smary.
Screw compressors, piston compressors, pneumatic tools,
hand tools, jacks, oils, lubricants.
Stoisko: F 158
Pneusej
ul. Nitrianska 109
92012 Hlohovec
Słowacja
tel./fax: +421 337 351 219
e-mail: [email protected]
www.pneusej.pl
Stoisko: B 26
Stoisko: C 52
Polboto-Agri Sp. z o.o.
Udanin 14
55-340 Udanin
83
Spis wystawców
List of exhibitors
tel.: +48 76 870 93 25
fax: +48 76 870 92 55
e-mail: [email protected]
Polboto-Agri Sp. z o.o.- Jesteśmy importerem na Polskę
przednich systemów zawieszania (TUZ i WOM) oraz napędów
gąsienicowych do kombajnów i ciągników marki Zuidberg,
czyszczarek do drenów Homburg i rozwadniaczy ŚOR Handler. Jesteśmy dystrybutorem systemów komputerowych do
zarządzania przechowalnią płodów rolnych Agratechnik, maszyn komunalnych Schouten oraz przyczep hakowych Toplift
Staja. Dealer ciągników John Deere oraz maszyn Vaderstad,
Manitou, Pottinger, Joskin. Zapraszamy do kontaktu.
akredytowany dostawca kolczyków do urzędowej identyfikacji
zwierząt. Wykonujemy projekty technologiczne, montujemy i
serwisujemy urządzenia. Doradzamy na każdym etapie cyklu
produkcyjnego. Proponujemy innowacyjne systemy żywienia,
pojenia i wentylacji. W swej ofercie posiadamy: - automaty
paszowe i urządzenia do automatycznego zadawania paszy
i wody, - paszociągi i silosy, - promienniki i nagrzewnice
gazowe, - poidła i karmidła, - mieszalnie pasz, - laguny na
gnojowice, - sprzęt weterynaryjno-zootechniczny, w tym do
sztucznej inseminacji, - papier dla piskląt, Klientom oferujemy:
- zaawansowaną myśl technologiczną, - błyskawiczny serwis,
- wyposażenie najwyższej jakości, - szkolenia technologiczne.
Posiadamy ponad 20 własnych oddziałów w całej Polsce.
Stoisko: D 79
We offer complex equipment for pig, poultry and cattle farms:
feeding and drinking systems, feed storages, ventilation systems, microclimate controllers. You will find in our offer also
wide range of breeding and veterinary equipment. We are one
of the main supplier of animal identification eartags.
Polcalc Sp. z o.o.
ul. Rewolucji 1905 r. 24/7A
90-207 Łódź
kom.: +48 781 602 600
e-mail: [email protected] polcalc.pl
www.polcalc.pl
Stoisko: E 441
Stoisko: A 331
Przedsiębiorstwo Motoryzacyjne POL-CAR Sp. z o.o.
ul. Gorzysława 9
61-057 Poznań
infolinia 0 800 161 022
Polsil Biopreparaty Sp. j.
ul. Okólna 128/7
87-100 Toruń
fax: +48 56 654 84 27
kom.: +48 502 790 856
e-mail: [email protected]
www.polsil.pl
Stoisko: B 341
Pol-Car jest dealerem samochodów Fiat, Alfa Romeo, Lancia,
Abarth, Jeep oraz aut dostawczych Fiata. Nowoczesny serwis
zapewnia fachową i szybką obsługę. Prowadzimy sprzedaż
hurtową i detaliczną części i akcesoriów do samochodów, skup i
sprzedaż aut używanych, wynajem samochodów, usługi blacharskie i lakiernicze, pomoc drogową, pośrednictwo finansowe.
Pol-Car is Fiat, Alfa Romeo, Lancia, Abarth and Jeep dealer.
We also sell Fiat vans. We offer professional and fast service
as well as wholesale and retail sale of spare parts and accessories for cars. We also buy and sell used cars, rent cars,
provide emergency towing and after accident repairs in our
body workshop. We offer financing plan services.
Stoisko: C522
POLNET Sp. z o.o. i Współnicy Sp. k.
ul. Obodrzycka 61
61-249 Poznań
tel./fax: +48 61 657 67 00
fax: +48 61 657 67 67
e-mail: [email protected]
www.polnet.poznan.pl
Firma Polnet działa od 1989 roku, specjalizując się w
kompleksowym projektowaniu i wyposażaniu obiektów inwentarskich dla wszystkich gałęzi produkcji zwierzęcej. Jesteśmy
wiodącym producentem i dystrybutorem sprzętu weterynaryjno-zootechnicznego. Od wielu lat funkcjonujemy jako
84
Polskie Wydawnictwo Rolnicze Sp. z o.o.
ul. Reymonta 9
60-79 Poznań
tel.: +48 61 869 06 30
fax: +48 61 867 98 65
e-mail: [email protected], [email protected],
[email protected]
www.topagrar.pl
www.tygodnik-rolniczy.pl
www.wydawnictwopwr.pl
top agrar Polska – profesjonalny, nowoczesny i sprawdzony
miesięcznik dla rolników. Publikowany z dodatkami: top
świnie, top bydło, top technika. Tygodnik Poradnik Rolniczy
– co tydzień aktualne informacje z branży rolnej, analizy cen
produktów rolnych, technika, uprawa roli, hodowla zwierząt.
Piękno & Pasje – magazyn o pięknych domach, pasjach osób
mieszkających poza miastem i wspaniałych miejscach.
top agrar Polska – professional, modern and tested monthly
for farmers. Published with additives: top pigs, top cattle, top
technology. Tygodnik Poradnik Rolniczy – every week updated
information from agricultural industry, analysis of prices of
agricultural products, technology, farming, animal husbandry.
Piękno & Pasje – the magazine about beautiful houses, passions people who live outside the city and wonderful places.
Stoisko: C 40
P
Polskie Zrzeszenie Producentów Bydła Mięsnego
ul. Kruczkowskiego 3
00-380 Warszawa
kom.: +48 668 495 304
e-mail: [email protected]
Stoisko: E 122
We manufacture and sell: tilling combined machines, tilling
and sowing combined machines, stubble tilling machines,
replacing ploughing, seeders, crushing rollers, mulch harrows, implements for front three-point linkage, heap aerators,
slurry mixers, straw bale uncoiler, wood splitting machines,
shredders.
Stoisko: C 191
Pol-Strautmann Sp z o. o.
ul. Nowotomyska 37
64-310 Lwówek
tel.: +48 61 441 20 57
fax: +48 61 441 20 22
www.strautmann.com
Stoisko: A 175
Przedsiębiorstwo Produkcyjno–Usługowo–Handlowe
POMAROL S.A.
ul. Przemysłowa 4
11-300 Biskupiec k/Olsztyna
tel.: +48 89 715 20 71
fax: +48 89 715 20 73
www.pomarol.com.pl
Producent maszyn rolniczych, zbiorników do paliw płynnych
oraz konstrukcji stalowych. W ofercie posiadamy: ładowacze
czołowe TUR, podnośniki przednie TUZ, kosiarki płozowe, kosiarki bijakowe, kosiarki do rowów i poboczy, kosiarki z koszem,
przetrząsaczo – zgrabiarki karuzelowe, uniwersalne zgarniacze
rolnicze, spychacze czołowe, wycinaki kiszonki, czerpaki rolnicze, wózki transportowe, odśnieżarki wirnikowe, ekologiczne i
zwykłe zbiorniki do paliw płynnych o poj. 1 – 100 m3.
P.P.H. i U. „POM KALISZ” Sp. z o.o.
ul. Tuwima 6
62-800 Kalisz
Dział sprzedaży
tel.: +48 62 767 30 91, 62 760 23 22
fax: +48 62 760 23 29
e-mail: [email protected]
www.pomkalisz.pl
Przenośniki kubełkowe do transportu pionowego wyd. od 2
do 120 t/h. Przenośniki ślimakowe: korytowe i rurowe wyd.
od 10 do 60 t/h. Redler o wyd. od 10 do 50 t/h. Rozdzielacze
wielodrogowe. Kosze przyjęciowe o różnych pojemnościach.
Kubełki. Budowa magazynów zbożowych.
Bucket conveyors for vertical transport – out-put from 2 to
120 t/h. Helical conveyors trough and pipe: (150, 200, 250,
350) – output from 10 to 60 t/h. Horizontal conveyors – output
from10 to 50 t/h. Multiline distributors. Reception baskets also
with worm selector of different capacities. Grain flour buckets.
We are producers of machines and equipment for agriculture.
We are offer: front tractor loaders TUR, front tractor three-point linkages, front tractor dozers, tractor snow blowers,
skid rotary mowers and flail bank mowers, tractor scoops,
silage block cutters, rotary rake-tedders, steel constructions,
fuel tanks of capacity 1 – 100 m3.
Stoisko: B 38
Stoisko: C 409
POM Ltd. Sp. z o.o.
ul. Graniczna 1
87-300 Brodnica
tel.: +48 56 498 24 71
fax: +48 56 498 24 72
e-mail: [email protected]
www.pomltd.com.pl
Produkujemy i sprzedajemy: agregaty uprawowe, uprawowo-siewne, agregaty ścierniskowe, zastępujące orkę, talerzowe,
siewniki zbożowe, wały kruszące, wahadłowe, brony mulczowe, narzędzia na przedni TUZ, aeratory pryzm materiałów
organicznych, miksery do gnojowicy, wieże montażowe do
mikserów, rozwijarki bel słomy, łuparki do drewna, kosiarki
bijakowe.
Pomorsko Mazurska Hodowla Ziemniaka Sp. z o.o.
z/s w Strzekęcinie
Strzekęcino 11
76-024 Świeszyno
tel.: +48 94 316 12 95
fax: +48 94 316 13 77
e-mail: [email protected]
www.pmax.pl
PMHZ to wiodąca firma hodowlana w Polsce działająca na
terenie województw: zachodniopomorskiego (Strzekęcin), pomorskiego (Jezierzyce i Celbowo) i warmińsko-mazurskiego
(Szyldak). Prowadzimy hodowlę twórczą i zachowawczą oraz
nasiennictwo ziemniaka. Produkujemy i dostarczamy kwalifikowane sadzeniaki na teren Polski i zagranicę. Aktualna oferta
— 20 odmian jadalnych o wysokich walorach smakowych i
15 skrobiowych o wysokim technologicznym plonie skrobi.
Poszukujemy producentów kwalifikowanych sadzeniaków.
85
Spis wystawców
List of exhibitors
PMZ is a leading breeding company in Poland, operating
in voivodeships: Western Poland (Strzekęcin), Pomeranian (Jezierzyce and Celbowo), and Warmian-Masurian
(Szyldak). We conduct potato creative and conservation
breeding, and production of seed material. We produce and
deliver qualified potato sets in Poland and abroad. Our current range includes 20 edible variants of very good flavour
parameters and 15 starch variants of high technological
starch yield. We are searching for farmers for production of
qualified potato sets.
nawozów; zamiatarki ciągnikowe zawieszane; urządzenia
pompujące do cieczy; separatory do ziarna; brony zębowe
zawieszane, rozdrabniacze bijakowe.
The company produces: platform augers with electric or
hydraulic drive; pneumatic conveyors (suction blowers,
blowers) with electric drive or drive from P.T.O. shaft; fertilizer
spreaders; mounted tractor sweepers; liquid pumping devices;
grain pre-cleaners; mounted tine harrows, grain hammer
crushers.
Stoisko: hala 5
Stoisko: C 276
Precyzyjnerolnictwo.com
ul. Ikara 10/2/8
81-197 Gdynia
fax: +48 742 57 56
kom.: +48 603 446 633
e-mail: [email protected]
www.precyzyjnerolnictwo.com
P.U-P. „POMOT” Sp. z o.o.
ul. Słowiańska 2, 74-500 Chojna
tel.: +48 91 414 21 82, 91 414 13 55
fax: +48 91 414 13 02
e-mail: [email protected]
www.pomot.pl
Stoisko: D 109
Producent wozów asenizacyjnych o poj. od 2500 l do 30
000 l oraz uniwersalnych rozsiewaczy nawozów i wapna z
przenośnikiem łańcuchowym o ładowności od 4 T do 24 T
z precyzyjnym systemem wysiewu GPS. Maszyn i urządzeń
komunalnych.
Stoisko: C 276
Porsche Inter Auto Polska Sp. z o.o. - Salon Volkswagen
Samochody Użytkowe w Suchym Lesie
ul. Obornicka 149
62-002 Suchy Las
fax: +48 61 650 05 50
kom.: +48 606 792 003
e-mail: [email protected]
www.vwuzytkowepoznan.pl
Stoisko: C 523
Poznańska Hodowla Roślin Sp. z o.o.
ul. Kasztanowa 5
63-004 Tulce
tel.: +48 61 872 79 50
fax: +48 61 872 79 55
e-mail: [email protected]
www.phr.pl
Stoisko: B 361
Premium Trade Sp. z o. o.
Kozenin 53D, 26-332 Sławno
Worów 50, 05-600 Grójec
ul. P. Ściegiennego 266, 25-116 Kielce
Konarzyce, ul. Łomżyńska 208B, 18-400 Łomża
kom.: +48 603 300 800
e-mail: [email protected]
www.Rolnicze-Maszyny.pl
www.MaszynyFabryczne.pl
www.JohnDeere24.pl
Premium Trade „Największy w Polsce Salon Nowych Maszyn
Rolniczych, Komunalnych, Leśnych, Sadowniczych” Autoryzowany dealer 64 różnych marek, dostępnych od ręki np. poprzez
Finansowanie Fabryczne, Dogodne Raty. Zapraszamy do zapoznania się z naszą ofertą na www.MaszynyFabryczne.pl lub
telefonicznie na całodobowej infolinii pod nr tel.: 603 300 800.
Premium Trade, „The largest saloon of new machines for
agriculture, municipal services, forestry and orcharding in
Poland”. An authorised dealer of 64 different makes, immediately available, e.g., with factory financing and adjusted
instalments. You can find more about our offer at www.
MaszynyFabryczne.pl or by calling 24-hour hotline at 603
300 800.
Stoisko: B 38
Pracowniczy Ośrodek Maszynowy
w Augustowie Sp. z o.o.
ul. Tytoniowa 4, 16 – 300 Augustów
tel.: +48 87 643 58 70; 643 34 76 – 78 wew. 113,114,116
fax: +48 87 643 67 18
e-mail: [email protected]
www.pom.com.pl
Firma produkuje: przenośniki slimakowe do zboża z
napędem elektrycznym i hydraulicznym; przenośniki
pneumatyczne do zboża (ssąco – tłoczące, tłoczące) z
napędem elektrycznym i od WOM ciągnika; rozsiewacze
86
Privé SA
98, avenue du Général Patton
51010 Chalons en Champagne - France
tel.: +333.2668.6662
kom.: +336.7122.6317
fax: +333.2668.6687
e-mail: [email protected]
www.prive.fr
PRIVE dysponuje 60-letnim doświadczeniem w produkcji
okrągłych silosów dla magazynowania zbóż, z blachy
P
falistej wraz galeriami,. Nasze wyroby wykonywane są ze
stali o najwyższych właściwościach wytrzymałościowych i
odporności na korozję. Obliczenia wytrzymałościowe oparte
są na aktualnych standardach europejskich. Pojemność od
20 do 10600 T. Dla więcej informacji prosimy o kontakt z
naszym przedstawicielem w Polsce: Fracop Sp. z o.o., 02823 Warszawa, ul. Wyczółki 101A, tel.: +48 22 644 28 02,
e-mail: [email protected]
Privé has more than 60 years’ experience in manufacturing
round corrugated silos and catwalks for grain storage. Our
products are made in high quality galvanised steel. Design
is based on the latest European standards. Capacities range
from 20 to 10.600 tons. For more information, please contact
our dealer in Poland.
Stoisko: E 298
Pro Agricola Sp. z o.o.
Naglady, ul. Wiejska 3
11-036 Gietrzwałd
Wydawca czasopism: Hodowca Drobiu, Indyk Polski,
Hodowca Bydła, Hodowca Trzody Chlewnej oraz katalogów
branżowych: Katalog Firm Drobiarskich, Katalog Firm
Paszowych i książek: Nowoczesna produkcja kurcząt
brojlerów, Vademecum chorób drobiu rzeźnego, Znane i
mniej znane rasy bydła. Firma rodzinna o wyłącznie polskim
kapitale.
Stoisko: C 498
Pro-Lab is a Polish company, which is in ANWIL SA corporation.
Our company is a producer of multicomponent fertilizers
with microelements: SONATA, SONATA MAKRO, SYMFONIA,
SYMFO-VITA, SERENADA, SUITA. This products are made
particularly for gardening (for greenhouses), agriculture and
flower plants.
Stoisko: A 324
PROMAR
Zakład Produkcji Maszyn Rolniczych
Złotki 49a
07-140 Sadowne
tel.: +48 25 791 92 82
fax: +48 25 740 55 61
e-mail: [email protected]
www.promar-zlotki.pl
Firma zajmuje się produkcją następujących maszyn
rolniczych: opryskiwacze polowe przyczepiane od 1000 do
4000 l, opryskiwacze polowe zawieszane od 300 do 1200
l, rozsiewacze nawozów jednotarczowe i dwutarczowe do
1400 kg, przetrząsacze karuzelowe, zgrabiarki karuzelowe,
belki herbicydowe, brony zębowe, przekładnie kątowe.
The PROMAR company produces the following agricultural
machines: trailed field sprayers of 1000 to 4000 l capacity,
mounted field sprayers of 300 to 1200l capacity, single-and
double-disc fertiliser sprayers of capacity up to 1400l, rotary
tedders, beams for herbicides, tooth harrows, angular gears
for fertiliser sprayers.
Stoisko: C 196
ProGrasS Polska Sp. z o.o.
ul. Przemysłowa 45
32-765 Rzezawa
tel.: +48 12 378 48 40
fax: +48 12 378 48 41
e-mail: [email protected]
www.prograss.pl
Stoisko: A 3
Pro-Lab Sp. z o.o.
ul. Toruńska 222
87- 800 Włocławek
tel.: +48 54 237 26 43, 237 36 48
tel./fax: +48 54 237 27 03
e-mail:[email protected]
www.prolab.pl
Polska firma nawozowa wchodząca w skład Grupy Anwil,
produkująca nawozy z makro i mikroelementami w postaci
chelatów, z serii: SONATA, SONATA MAKRO, SYMFONIA,
SYMFO-VITA, SERENADA, SUITA. Nawozy adresowane są do
producentów rolnych i ogrodniczych oraz działkowiczów.
PHU PRONAR Dariusz Kawka
Gajków, ul. Wrocławska 1
55-002 Kamieniec Wrocławski
tel.: +48 71 381 96 81
fax: +48 71 381 96 01
PHU PRONAR oferuje zabudowę samochodów użytkowych
w systemie BOTT VARIO łączący w sobie funkcjonalność
i bezpieczeństwo. Niezawodność i perfekcja wykonania
potwierdzone licznymi testami pozwala zaoferować użytkownikowi 3 letnią gwarancję. Dodatkowo w ofercie mamy:
bagażniki dachowe do przewozu drabin, narzędzia ręczne,
elektronarzędzia, linie montażowe.
PHU PRONAR offers commercial in- vehicle eqvipment
BOTT VARIO system that combines functionality and safety.
Reliability and perfect workmanship confirmed in many tests
allows us to offer you a 3 year warranty. Additionally, we
offer: roof racks to carry ladders, hand tools, power tools,
assembly lines.
Stoisko: D 104
87
Spis wystawców
List of exhibitors
Protechnika
ul. Żelechowska 67
21-400 Łuków
tel./fax: +48 25 798 97 02
e-mail: [email protected]
www.protechnika.com
Firma oferuje linie do produkcji brykietu, pelletu oraz wytwarzania estrów metylowych z olejów roślinnych. Oferujemy
granulatory, brykieciarki hydrauliczne, młyny, prasy do
tłoczenia oleju. Ponadto posiadamy w ofercie młyny frezowe
oraz inne urządzenia do rozdrabniania drewna, gumy, tworzyw
sztucznych.
The company offers lines for the production of briquette,
pellets and for producing methyl esters from vegetable oils.
We offer granulators, hydraulic briquette machines, mills, oil
presses. In addition, in our offer we have a cutter mills and
other equipment for chopping wood, rubber, plastics.
Stoisko: D 89
Przedsiębiorstwo Romanowski
Sędławki 24
11-200 Bartoszyce
tel.: +48 89 762 17 38
fax: +48 89 762 66 15
e-mail: [email protected]
www.romanowski.pl
Stoisko: D 286
P.W. BORYS s.c.
Waldemar Kaczmarek, Patryk Latos
Jankówko 1E
62-200 Gniezno
tel.: +48 61 425 27 98
fax: +48 61 425 27 98
kom.: +48 601 531 136; 721 087 449
e-mail: [email protected]
www.pwborys.pl
Firma BORYS jako jedyna w Polsce zajmuje się profesjonalnym montażem stałych ogrodzeń elektrycznych, które
cechuje wysoka jakość materiałów oraz estetyczny wygląd.
W naszej ofercie znajdą Państwo również: panele ogrodzeniowe, poskromy, poidła i paśniki. Oferowane artykuły zostały
sprawdzone pod względem ich przydatności i funkcjonalności
we własnej hodowli. Gwarantujemy fachowe doradztwo.
Pro-Vega Sp.J.
ul. Małszyce 60
99-400 Łowicz
tel.: +48 46 811 55 22
e-mail: [email protected]
www.pro-vega.pl
Polski producent profesjonalnych maszyn i kompletnych linii
do pozbiorowej obróbki warzyw korzeniowych; wywrotnice
skrzyniopalet, zasobniki dozujące i buforowe, separatory ziemi
i kamieni, myjnie bębnowe i szczotkowe, polerki do warzyw,
kalibrownice, stoły rolkowe, ogławiarki marchwi, podajniki i
transportery. Projektowanie techniczne i technologiczne linii
do warzyw.
Producer of professional machines (and complete processing
lines) for handling of vegetables: box tippers, dosing and
buffer hoppers, desoilers and wet destoners, drum and
drum-brusher washing machines, vegetable polishers,
selection belt and roller conveyors, carrot top cutters, dosing
transporters, etc.
Stoisko: C 527
Provsolar
ul. Sportowa
74-100 Chwarstnica
tel.: +48 91 482 40 50
fax: +48 91 482 40 50
e-mail: [email protected]
www.provsolar.com
Stoisko: F 457
Stoisko: D 421
Przemysłowy Instytut Motoryzacji
ul. Jagiellońska 55
03-301 Warszawa
tel.: +48 22 777 70 00
fax: +48 22 777 70 20
e-mail: [email protected]
www.pimot.eu
Przemysłowy Instytut Motoryzacji PIMOT jest instytutem badawczym, który dostarcza polskim przedsiębiorcom silnego wsparcia
naukowego i zaplecza laboratoryjnego w procesie doskonalenia ich wyrobów. Instytut bada, certyfikuje i opiniuje wyroby
motoryzacyjne i paliwa. Prowadzimy liczne prace badawcze
kompletnych pojazdów, zespołów i elementów pojazdów, w tym
również badania z zakresu bezpieczeństwa i ochrony środowiska.
The Automotive Industry Institute is a research institute,
wchich provides polish traders with scientific suport to improve their production. Institute carries out tests, certificates and
makes opinion about motorization products and a fuel. We are
doing research on the vehicles and parts of vehicles, also on
safety and environmental protection.
Stoisko: A 11
88
R
PT&M- CENTRUM RUCHOMYCH PODŁÓG
ul. Zgierska 250/252
91-364 Łódź
tel./fax: +48 42 658 10 97
e-mail: [email protected]
www.ptmtrade.pl
RABAUD SAS
Bellevue - 85110 SAINTE CECILE
Francja
tel.: 02 51 48 51 51
fax: 02 51 48 51 53
Firma PT&M z siedzibą w Łodzi zajmuje się dystrybucją lekkich
i wytrzymałych naczep marki STAS, przyczep podkontenerowych marki Hüffermann, systemów ruchomych podłóg Cargo
Floor oraz KWF. Dział pojazdów używanych zajmuje się zarówno odkupem, sprzedażą, jak i wynajmem. Oferujemy fachowe
doradztwo i kompleksową obsługę w zakresie technologii
ruchomych podłóg, a także sieć serwisową w całej Polsce.
Company PT & M based in Lodz is a distributor of light and
heavy-duty trailers STAS, Hüffermann container trailers, moving floor systems Cargo Floor and KWF. Department of used
vehicles is involved in re-purchase, sale and leasing. We offer
expert advice, comprehensive services in the area of moving
floor technology and service network throughout the country.
Stoisko: E 233
We are located on a 10 acres site in France since 1980.
RABAUD company designs, manufactures and trades
equipment for agriculture, building and construction (PW),
and Garden and Landscape businesses. We trade through
our current commercial network or for industrial partnership.
The strategic keyword of RABAUD: constant innovation and
machines being available.
Stoisko: E 298
Raiffeisen Agro - Technika Sp. z o.o.
ul. Bydgoska 41
86-061 Brzoza k/Bydgoszczy
tel.: +48 52 381 04 15
fax: +48 52 381 06 09
e-mail: [email protected]
Stoisko: C 280
Powszechny Zakład Ubezpieczeń SA
Al. Jana Pawła II 24
00-133 Warszawa
Infolinia 801 102 102
www.pzu.pl
Stoisko: E 232
PPH R.J.-Rolimpex
Osada Bystre 18 A
56-400 Oleśnica
tel./fax: +48 71 399 01 54
e-mail: [email protected]
www.rjrolimpex.pl
PPH R.J.-Rolimpex działa na rynku od 1991r. i zajmuje się
wytwarzaniem wszelkiego rodzaju urządzeń zootechnicznych
(zwłaszcza poideł dla bydła i trzody), narzędzi ogrodniczych
oraz części do ciągników i maszyn rolniczych. Elastyczność
produkcji, oprócz standardowej oferty, umożliwia realizację
projektów indywidualnych. Swoją działalność handlową
opieramy na solidnych partnerach z kraju i zagranicy.
R.J.-Rolimpex is a dynamic and well prospering polish
company, gladly working with foreign clients. We specialize in
production of farming, gardening and zootechnic equipment
such as tractor and machine parts,cattle and stock watering,drinking systems, cattle and stock marking and gardening
tools. Our machine park allows flexible and high volume
production. We realize standard and custom projects.
Raiffeisen-Leasing Polska S.A.
ul. Prosta 51
00-838 Warszawa
tel.: +48 22 326 36 00
fax: +48 22 326 36 01
e-mail: [email protected]
www.rl.com.pl
Raiffeisen-Leasing Polska S.A. jest nowoczesną i
dynamicznie rozwijającą się instytucją finansową o
ugruntowanej pozycji na polskim rynku leasingu. Ofer tę
firmy cechuje różnorodność produktów oraz uniwersalność. Spółka leasinguje wszelkiego rodzaju środki trwałe,
poczynając od środków transpor tu, wyspecjalizowane
maszyny i urządzenia, linie technologiczne oraz nieruchomości.
Raiffeisen-Leasing Polska S.A. is a modern and dynamically
growing financial institution with a well-established position
on the Polish leasing market. Raiffeisen-Leasing Polska S.A.’s
universal offer features a variety of products. The company
leases all types of PP&E, such as means of transport, specialised machinery and equipment, process lines, office facilities
and real property.
Stoisko: C 384
Stoisko: F 486
89
Spis wystawców
List of exhibitors
Rapool Polska Sp. z o.o.
ul. Straszewska 70
62-100 Wągrowiec
tel.: +48 67 268 07 10
fax: +48 67 268 07 15
e-mail: [email protected]
www.rapool.pl
ul. Doktora Ludwika Zamenhofa 2
tel./fax: +48 58 562 31 07, 58 562 58 63
tel.: +48 664 944 758
e-mail: [email protected]
Stoisko: B 367
Remprodex Sp. z o. o.
Człuchów, ul. Jerzego z Dąbrowy 3
77-300 Człuchów
tel.: +48 59 834 22 88
fax: +48 59 834 22 80
e-mail: [email protected]
www.remprodex.com.pl
Maszyny do uprawy i konfekcjonowania warzyw i ziemniaków: sadzarki, obsypniki, taśmociągi, przenośniki, stoły selekcyjne, wago workownice, kosze przyjęciowe, czyszczarki,
obrotnice i wywrotnice do skrzyniopalet. Ponadto wykonujemy wszelkiego rodzaju konstrukcje stalowe i kontenery.
Machines for cultivaing and sorting vegetables and potatoes:
planters, sorters, ridging ploughs, conveying belt, conveyors, sorting tables, weighing and packing machines, intake
baskets, clenners, crate-palette, rotating and tilting equipment.
Moreover, we make any type steel construction and containers.
Stoisko: F 253
Firma Restal powstała w 1980 r. Przedsiębiorstwo oferuje
szeroki zakres usług w zakresie projektowania i konstrukcji
maszyn na potrzeby rolnictwa. W naszej ofercie znajdziecie
Państwo szeroką gamę maszyn i urządzeń, które produkujemy w oparciu o indywidualne życzenia i potrzeby klienta.
Firma posiada certyfikat jakości ISO 9001, a także ma prawo
wydawania znaku CE na produkowane urządzenia.
Restal company was founded in 1980. Firm offers a wide
range of services in the design and construction of machines
for agriculture. In our offer you will find a wide scope of
machinery and equipment which is manufactured according
to individual wishes and needs of the customer. The company
is certified according to ISO 9001, and also has the right to
issue the CE mark on manufactured devices.
Stoisko: D 413
Richel Group
ZA des Grandes Terres
13810 EYGALIERES
Francja
tel.: +33(0)4 90 95 14 68
fax: +33(0)4 90 95 12 93
e-mail: [email protected]
REMSZ Klimczak Sp. j.
ul. Lutomierska 144A
91-041 Łódź
tel.: +48 42 659 50 06
fax: +48 42 659 52 65
e-mail: [email protected]
www.remsz.com
Firma Richel Serres de France jest producentem Shelterall®,
hal tunelowych używanych zarówno do przechowywania
maszyn rolniczych, do magazynowania płodów rolnych, jak i
w hodowli zwierząt. Szkielet nośny Shelterall® wykonany jest
z najwyższej jakości stali ocynkowanej, a pokrycie z brezentu
ma 10-cioletnią gwarancję. Zastosowane rozwiązania techniczne umożliwiają szybki montaż i demontaż Shelterall.
Oferujemy: węże płaskie, rury oraz osprzęt do deszczowni,
detonatory zasilane gazem propan-butan z butli od 1 do 11
kg. Urządzenia te mają regulację głośności eksplozji od 85
do 125 dB oraz regulację częstotliwości wystrzałów od 2 na
minutę do 2 na godzinę, siatki chroniące drzewa i krzewy
owocowe przed ptakami, agrowłókninę.
Richel Serres de France created Shelterall®, universal shelters that can be used for storage of agricultural machinery or
agricultural products, as well as in animal farming. Shelterall®
is made from high quality galvanized steel and the covering of
tarpaulin has a 10-years’ warranty. Our innovative technology
enables quick assembly and disassembly of Shelterall®.
Stoisko: D 551
We offer: flat hoses, pipes and irrigation equipment, one of
the most effective and portable scarecrow devices that uses
propan-butan gas containers (volume from 85 to 125 dB and
shot frequency from two shots per minute to two shots per
hour), proffesional tree protecting netting, natural fibre.
Stoisko: C 68
Zakład Wyrobów Metalowych RESTAL
83-200 Starogard Gdański
90
Landtechnik Gut Renzow GmbH
RICHIGER Europe
D-19209 Renzow, Niemcy
tel.: +49(0)3887422067
www.richiger.de
RICHIGER Polska
Rafał Sułkowski
tel.: +48 698 456 746
e-mail: [email protected]
www.silos-bag.pl
R
Richiger oferuje kompleksową gamę maszyn do przechowywania suchych, mokrych i zagniecionych zbóż w rękawach
foliowych. Maszyny obejmują workownice, gniotowniki,
rozładowywacze, zsypy i przyczepy do ziarna.
Richiger offers the whole range of machines for the storage
of dry, wet and cracked grain and other products in 6, 9 or
10 feet Silobags. The machines include, grain baggers, grain
crimper baggers, hammer mills, unloaders and grain carts.
Stoisko: B 32
POLSKA
Oni robią to po mojej myĞli.
Riela Polska Sp. z o.o.
Kartoszyno, ul. Przemysłowa 3
84-110 Krokowa
tel.: +48 58 675 49 40
fax: +48 58 675 49 50
e-mail: [email protected]
www.riela.pl
Stoisko: D 290
magazynów. Oferujemy: poliwęglan komorowy i lity; płyty
faliste i trapezowe z PET i PCV; odporny na zwierzęce odchody poliester wzmocniony włóknem szklanym tłumiący hałas
deszczu w postaci rulonów falistych i płaskich, płyty trapezowe z poliestru dopasowany do profili blach trapezowych;
systemowe daszki do drzwi wejściowych, płyty higieniczne
PCV z jonami srebra.
Stoisko: D 539
Firma Roland Produkcja Handel Usługi Ryszard Drąg
ul. Parkowa 25a
88-140 Gniewko
tel.: +48 52 351 01 44
[email protected]
www.roland.biz.pl
Stoisko: F 488
Rolkap
ul. Lwowska
22-400 Zamość
kom.: +48 601 320 747
[email protected]
www.rolkap.pl
Stoisko: E 576
RO.SA.- HALE Sp z o.o.
Starokrakowska 133,
26-600 Radom
tel.: +48 48 366 14 40
fax: +48 48 366 56 70
e-mail: [email protected]
RO.SA.-HALE - budowa hal stalowych i obiektów przemysłowych. Projektujemy i budujemy hale dla sektora spożywczego, w tym dla Grup Producentów. Nasze realizacje obejmują
między innymi: hale stalowe produkcyjne i magazynowe,
sortownie oraz przechowalnie owoców i warzyw, mroźnie i
chłodnie, obiekty biurowe, centra logistyczne. Zapraszamy na
www.rosahale.pl.
RO.SA.-HALE – complex execution of industrial objects. We
design and build halls for agricultural sector, including Producer’s Groups. Our realizations are among others: production
steel halls and store rooms, stores of fruits and vegetables,
carrying freezers, cold stores, social and office buildings, logistical centers. We invite You to our website www.rosahale.pl.
Stoisko: hala 15
Robelit Sp. z o.o.
42-200 Częstochowa,
ul. Legionów 79
tel.: +48 34 377 42 28
sekretariat: +48 34 377 42 98
fax: +48 34 377 42 99
e-mail: [email protected]
www.robelit.pl
Rolmako - Maszyny i części dla rolnictwa
Psary Małe k. Wrześni
ul. Gwarna 8
62-300 Września
tel.: +48 61 438 87 35
fax: +48 61 437 39 16
e-mail: [email protected]
www.rolmako.pl
Firma Rolmako prezentuje szeroki pakiet rozwiązań rolniczych.
Aktualnie produkowane są przystawki do zbioru rzepaku,
elektryczne i hydrauliczne kosy boczne do rzepaku, wózki do
hederów zbożowych, agregaty uprawowo-siewne, głębosze,
kultywatory podorywkowe, brony talerzowe, ciężkie brony
ścierniskowe, agregaty do bezorkowej uprawy gleby, zgniatacze ziarna, pługi śnieżne oraz owijarki bel. Firma specjalizuje
się również w wykonywaniu części do maszyn produkcji
zagranicznej. Są to głównie części do kombajnów zbożowych:
sita, klepiska, podsiewacze i inne.
The Rolmako company presents a wide range of agricultural
solutions. Currently there are produced: rape harvesting
extensions, electric and hydraulic rapeseed side knifes,
header trailers, seedbed cultivators, subsoilers, skimming
cultivators, disc harrows, heavy stubble harrows, tillage
aggregates without plowing the soil, grain crushers, snow
ploughs and ensilage wrapping machines. The company
also specializes in spare-parts manufacturing for machines
of foreign production. Mainly, it is about spare-parts for
combine harvesters: sieves, threshing floors, grain pans and
others.
Stoisko: A 176
Robelit Sp. z o.o. – dostawca materiałów z tworzyw sztucznych do wykonywania doświetleń, ścianek wygradzających
i sufitów podwieszanych budynków gospodarczych, wiat i
91
Spis wystawców
List of exhibitors
9001:2008 i Certyfikat TUV na spawanie. Oferuje części do
maszyn: budowlanych, rolniczych, dla przemysłu petrochemicznego i kolejowego. Produkuje także: przyczepy rolnicze,
siewniki talerzowe, agregaty uprawowo–siewne, kombajny,
kultywatory podorywkowe.
Przedsiębiorstwo Handlowo Usługowe
ROLMASZ-POL
Wolica Pusta 1a
63-040 Nowe Miasto n/Wartą
tel.: +48 61 286 69 71…72
tel./fax: +48 61 287 41 64
e-mail: [email protected]
www.rolmasz-pol.com.pl
Wyłączny przedstawiciel na Polskę firmy GERINGHOFF
produkującej przystawki do zbioru kukurydzy na ziarno oraz
składane hedery zbożowe. Jedyny autoryzowany serwis tej
firmy w kraju. Centralny magazyn części zamiennych GERINGHOFF w Polsce.
We are the main GERINGHOFF representative in Poland, which
produces headers for corn harvesting and collapsible headers
of grain. We are the only authorized GERINGHOFF service
in our country. We are the central warehouse GERINGHOFF
spare parts in Poland.
ROLMETAL company is located in Olkusz. The company is
equipped with 5-axis CNC milling machine, CNC lathes and
welding robot. We have a modern CAD/CAM software (SolidWorks/Edgecam). It has ISO 9001:2008 and TUV certificate
for welding. We produce parts for building machines, agricultural, petrochemical industry and railways. It also produce:
trailers, disc seeders, cultivate-sowing aggregates, combine
harvesters, cultivators.
Stoisko: A 172
Rolmus P.P.H.U.T. Export-Import Mieczysław Szymkowiak
ul. Akacjowa 6
62-300 Września
tel.: +48 61 436 67 54
fax: +48 61 436 09 79
e-mail: [email protected]
www.rolmus.com.pl
Stoisko: F 165
Stoisko: F 136
Rolnictwo Precyzyjne Andrzej Przeperski
Wybudowanie 30
83-130 Pelplin
tel.: +48 605 32 07 76
e-mail: [email protected]
www.rolnictwoprecyzyjne.com.pl
Stoisko: D 96
Zakład Wytwórczo Usługowy ROLMET s.c.
Rożno Parcele 37 A
87-700 Aleksandrów Kujawski
tel.: +48 54 282 56 36
tel./fax: +48 54 282 85 67
e-mail: [email protected]
www.przenosnikirolmet.pl
Produkujemy przenośniki ślimakowe do transportu zboża,
kukurydzy, nasion roślin oleistych, paszy. Wykonujemy nietypowe urządzenia związane z transportem poziomym i pionowym oraz innych materiałów sypkich: styropian, cement,
trociny, sól, kawa. Projektujemy, produkujemy, doradzamy,
zapewniamy serwis i części zamienne.
We produce screw conveyors for transport of grain,
maize, oil plant seed, fodder, etc. We also produce special
devices for horizontal and vertical transport of other bulk
materials like Styrofoam, cement, sawdust, salt, coffee.
We design, produce, counsel and offer servicing and spare
parts.
Stoisko: C 392
Przedsiębiorstwo Produkcyjno Handlowe ROLMETAL
T. Kubańska, J. Kubański Sp. j.
ul. Kluczewska 2a
32-300 Olkusz
Firma ROLMETAL mieści się w Olkuszu. Przedsiębiorstwo
jest wyposażone w 5–osiowe maszyny numeryczne, tokarki
i robota spawalniczego. Posiada nowoczesne oprogramowanie CAD/CAM (SOLIDWORKS/EDGECAM), Certyfikat ISO
92
ROLSTAL Pawłowski
Janusz Pawłowski
07-300 Ostrów Mazowiecka
ul. Różańska 45
tel.: +48 29 645 74 00
fax: +48 29 645 74 70
e-mail: [email protected]
www.rolstal.pl
www.rolsta-hale.pl
Firma ROLSTAL Pawłowski powstała w 1989 r. jest wiodącym
w kraju producentem hal stalowych i wyposażenia budynków
inwentarskich dla bydła, trzody i koni. Działalność firmy i
jakość oferowanych wyrobów została wielokrotnie nagrodzona na wielu wystawach w branży hodowlanej. W bogatej
ofercie firmy znajdują się: konstrukcje stalowe budynków
inwentarskich; wyposażenie do hodowli bydła; wyposażenie
do hodowli trzody; stajnie i ujeżdźalnie dla koni. Zapraszamy
na nasze stoisko na targach.
The company ROLSTAL Pawłowski was founded in 1989 and
is a leading Polish manufacturer of steel halls and livestock facilities for cattle, pigs and horses. The company operations and
quality of offered products have been recognised many times
at numerous fairs for animal breeding industry. Our extensive
product range includes: steel structures for livestock facilities;
S
equipment for cattle breeding; equipment for pigs breeding;
stables and riding arenas for horses. Visit our stand at the Fair!
Stoisko: F 456
Roltech-Conow Sp. z o.o
ul. Wołczyńska 43
60-003 Poznań
fax: +48 91 564 13 60
kom.: +48 503 690 773
e-mail. [email protected]
www.roltech-conow.pl
S.C. Tomit Agri Macchine srl
Calea Brailei 18
081520 Judetul Braila
Rumunia
tel.: 0040 726718987
fax: 0040 2396 68251
e-mail: [email protected]
www.itagrigroup.ro
Stoisko: E 605
Firma Roltech- Conow Sp. z o.o. reprezentuje na polskim
rynku specjalistę w produkcji przyczep rolniczych i komunalnych, burtowych, skorupowych, platform i specjalistycznych,
największego niemieckiego producenta przyczep HW 60 i HW
80 Conow Anhängerbau GmbH &Co. KG. Solidna konstrukcja
i szczelność nadwozia to znaki firmowe naszych produktów.
The company Roltech- Conow Sp. z o.o. represents in the
Polish market a specialist in production of agriculture and
municipal flatbed and half-pipe, platform and specialist
trailers from the largest German producer of HW 60 and HW
80 Conow Anhängerbau GmbH &Co. KG. Our products are
distinguished by their solid structure and tight body.
SALIDA Sp. z o.o.
Makowice 36
58-100 Świdnica
tel.: +48 74 833 53 52
fax: +48 74 833 59 50
e-mail:[email protected]
www.salida.pl
W naszej ofercie maszyny firm: AGREX (suszarnie, rozsiewacze); GASPARDO (siewniki, głębosze) GALUCHO (brony
talerzowe); GREFFET (koparki do rowów), KVERNELAND-ACCORD (siewniki); MASCHIO (brony, kosiarki, glebogryzarki);ZANOTTI (czyszczalnie). Zapewniamy pełne zabezpieczenie
w części zamienne oraz serwis gwarancyjny i pogwarancyjny
do oferowanych maszyn.
Stoisko: F 248
Our offer includes machines from the companies: AGREX
(dryers, spreaders) GASPARDO (seeders, subsoilers)
GALUCHO (disc harrows) GREFFET (ditch diggers), KVERNELAND-ACCORD (seeders), MASCHIO (harrows, mowers,
rotary cultivators);ZANOTTI (cleaners). We provide full range
of spare parts together with guarantee and post-guarantee
service for offered machines.
Roltop Sp. z o.o.
Cedry Małe, ul. Wiślana 4
83-020 Cedry Wielkie
tel.: +48 58 683 61 15
fax: +48 58 683 63 15
e-mail: [email protected] www.roltop.pl
Stoisko: C 402
Stoisko: C 274
PHUP ROLTRANS Waldemar Kobyliński
ul. Mazowiecka 18
06-200 Maków Maz.
tel.: 600 884 440
e-mail: [email protected]
PHUP ROLTRANS Waldemar Kobyliński z siedzibą w Makowie
Maz. - w sercu Polski niedaleko Warszawy, jest wiodącym
producentem rozrzutników obornika. Jako przedsiębiorstwo
z 25-letnim doświadczeniem wytwarzamy sprzęt rolniczy
najwyżej jakości. W ofercie proponujemy Państwu rozrzutniki
obornika o ładowności 4, 6, 8, 10 ton. Dbając o wysoką jakość
świadczonych usług, zdobyliśmy zaufanie wielu Klientów. Liczymy na owocną współpracę. Wierzymy, że przyniesie to nam
obopólne korzyści i przyczyni się do dynamicznego rozwoju.
Stoisko: F 251
Ryu Arm Polska Jadwiga Szczurek
ul. Długa 10
42-674 Łubie
tel.: +48 32 305 21 82
fax: +48 32 302 18 74
e-mail: [email protected]
www.ryuarm.pl
Stoisko: E 451
SaMASZ Sp. z o.o.
ul. Trawiasta 15
15-161 Białystok
tel.: +48 85 664 70 31
fax: +48 85 664 70 41
e-mail: [email protected]
Firma SaMASZ została założona w 1984r. Dzięki ciągłemu
inwestowaniu w nowoczesny park maszynowy oraz wykwalifikowaną kadrę inżynierską osiągnęła pozycję największego
polskiego i jednego z czołowych europejskich producentów maszyn rolniczych i komunalnych. W swojej ofercie
posiadamy ponad 200 typów maszyn: kosiarek bębnowych,
dyskowych, przetrząsaczy, zgrabiarek, kosiarek bijakowych i
pługów śnieżnych.
Company SaMASZ was founded in 1984. Due to constant
development we have gained position of the biggest polish
and one of the major european manufacturers of grassland
machinery. Our offer consists of around 200 different types of
93
Spis wystawców
List of exhibitors
machines: drum and disc mowers, rotary rakes and tedders,
flail mowers, arm-type flail mowers and snow plows.
Stoisko: D292
Hans Sauter GmbH Auerbachweg 13
87778 Stetten
Germany
tel.: +49 8261 7599427
fax: +49 8261 7599420
www.sauter-stetten.com
Same Deutz-Fahr Polska Sp. z o.o.
Jacków 15, 21-007 Mełgiew
tel.: +48 81 469 60 90
fax: +48 81 469 60 99
e-mail: [email protected]
www.samedeutz-fahr.pl
Stoisko: F 150
SAME DEUTZ-FAHR POLSKA Sp. z o.o. prowadzi sprzedaż
traktorów o mocach od 35 do 270 KM w markach: SAME,
LAMBORGHINI, DEUTZ-FAHR oraz kombajnów, ładowarek
teleskopowych i maszyn z linii zielonkowej marki Deutz-Fahr.
Sprzedaż jest realizowana poprzez sieć dealerską zapewniającą ponadto serwis oraz sprzedaż części zamiennych.
SAME DEUTZ-FAHR POLSKA Sp. z o.o. is one of the branches
of Same Deutz-Fahr Group. SDFP sells whole range of tractors
from 35 up to 270 HP in three brands: SAME, LAMBORGHINI,
DEUTZ-FAHR as well as combines, telehandlers and forage
equipment of DEUTZ-FAHR. With well organized Dealers’ network ensures good quality of sales and after sales services.
Stoisko: C 275
MarketBook
208, rue de Noertzang
L-3670 Kayl
Luxembourg
tel.: +352 26 56 67 10
e-mail: [email protected]
www.MarketBook.com
Schaeffler Polska Sp. z o.o.
ul. Szyszkowa 35/37
02-285 Warszawa
tel.: +48 22 878 31 65
fax: +48 22 878 31 64
e-mail: [email protected]
www.schaeffler-aftermarket.pl
Grupa Schaeffler, wraz ze swoimi markami LuK, INA i FAG,
jest wiodącym producentem łożysk tocznych, ślizgowych
oraz rozwiązań z zakresu napędów bezpośrednich liniowych
i obrotowych, a także dostawcą precyzyjnych produktów i
rozwiązań dla silników, skrzyń biegów i podwozi. Będąc światowym liderem technologii suchych sprzęgieł do traktorów,
LuK dostarcza na pierwszy montaż i rynek części zamiennych szeroki asortyment docisków sprzęgła, tarcz i łożysk
oporowych, również jako kompletne zestawy LuK RepSet®.
Dodatkowo elementy tłumiące drgania gwarantują wyższy
komfort użytkowania we wszystkich warunkach pracy.
Stoisko: E 604
MarketBook.com jest miejscem w Internecie, które stanowi
bazę samochodów ciężarowych, maszyn rolniczych oraz
sprzętu budowlanego i jest areną wzajemnych transakcji
pomiędzy kupującymi i sprzedającymi. Zatrzymaj się przy
naszym stoisku i odbierz darmowy katalog!
MarketBook.com is a one stop web destination for truck,
farm, and heavy equipment buyers and sellers. Stop by our
stand to preview our website and pick up a free publication!
Stoisko: hala 21
Sano – Nowoczesne Żywienie Zwierząt Sp. z o.o.
ul. Lipowa 10
64-541 Sękowo
tel.: +48 61 294 11 00
fax: +48 61 291 96 55
e-mail: [email protected]
www.sano.pl
Stoisko: B 352
94
Scharmüller Gesellschaft m.b.H. & Co KG
Doppelmühle 14
4892 Fornach
tel.: +43 (0)7682/6346-0
fax: +43 (0)7682/6346-50
e-mail: [email protected]
www.scharmueller.at
Przedstawiciel w Polsce:
Adam Kalinowski
e-mail: [email protected]
kom.: +48 603 645 009
Jesteśmy austriackim producentem zaczepów. Oferujemy
zaczepy oczkowe i kulowe K80, automatyczne i manualne zaczepy transportowe, płyty nośne, zaczepy do przyczep, sprzęgi, korpusy, zaczepy pitonfix, hitche, części zamienne itp. W
swojej ofercie posiadamy zaczepy praktycznie do wszystkich
marek ciągników m.in.: John Deere, MF, NH, Valtra, Fendt,
Case, JCB, Kubota, Claas, TYM, Ursus, Zetor itd.
S
We are austrian producer of couplings to tractors and
agricultural machinery. We offer: ladder hitches, pick-up
hitches, heavy duty drawbars, clevis types, inserts for ladder
hitches, towing eyes, forced steering components etc. We
have couplings to many different tractors on the market: John
Deere, Massey Ferguson, New Holand, Valtr, Fendt, Case,
JCB, Kubota, Claas, TYM, Ursus, Zetor etc.
managed to retain its position through listening to the needs of
the public, early observation of future needs, and keeping up
with technological developments.
Stoisko: E 131
Stoisko: C 205
Kotły Centralnego Ogrzewania SEKO
Zbigniew Sitek
ul. Transportowców 12
39-200 Dębica
tel.: +48 14 68 31 000
fax: +48 14 68 26 404
e-mail: [email protected]
www.seko.pl
Schaumann Polska Sp. z o.o.
ul. Chrobrego 14
62-200 Gniezno
tel.: +48 61 424 52 05 / 06
fax: +48 61 424 52 07
e-mail: [email protected]
www.schaumann.pl
Schaumann – specjalista w żywieniu, chowie i hodowli
zwierząt, to firma z ponad 70-letnią tradycją. Odpowiednio
dopasowany system firmy Schaumann oferuje każdemu
producentowi zwierząt, niezależnie od wielkości, indywidualne rozwiązania umożliwiające stałe powiększanie
jego sukcesu w gospodarstwie. Posiada w swojej ofercie:
premiksy, mieszanki paszowe uzupełniające, prestartery,
koncentraty, pasze, preparaty mlekozastępcze, zakwaszacze
oraz zakiszacze.
Schaumann – a specialist in animal feeding, rearing and
breeding, is a company which tradition reaches for more
than 70 years back. An appropriately adapted system
developed by the company Schaumann offers individual
solutions for each animal breeder, regardless of its size,
enabling continuous increase in its farming success. Our
range includes: premixes, supplementary feed mixtures,
prestarters, concentrates, feeds, milk replacers, acidifiers
and ensiling agents.
Firma SEKO od prawie 40 lat zajmuje się produkcją kotłów na
paliwa stałe. Obecnie w swojej ofercie posiadamy kotły o mocy
od 7,5 do 200 kW, zarówno zasypowe jak i z podajnikami.
Produkowane kotły mogą być opalane węglem kamiennym,
miałem węglowym, eko-groszkiem, peletem, owsem lub drewnem. Zakupione kotły dostarczamy bezpłatnie na terenie kraju.
Stoisko: D 568
SERAFIN P.U.H.
Przybysławice 113
32-088 Przybysławice
tel.: +48 12 419 45 45
fax: +48 12 398 36 69
e-mail: [email protected]
www.serafin-maszyny.com
www.serafin.agro.pl
Stoisko: B 349
Schuitemaker Machines BV
Morsweg 18
7460 AG Rijssen
Holland
tel.: +48 885 855 886 (Polska)
www.sr-schuitemaker.nl
Schuitemaker Machines B.V. powstała w 1918 r. I od początku
nieprzerwanie działa w produkcji maszyn dla sektora rolniczego oraz przemysłowego. Dzięki wieloletniemu doświadczeniu,
firmie Schuitmaker udało się osiągnąć uprzywilejowaną
pozycję w obu sektorach, głównie dzięki temu, że słucha potrzeb klientów oraz dzięki podążaniu za najnowszym rozwojem
technologicznym.
Schuitemaker Machines was established in 1918. Many years
of experience in combination with a very strong image have
given Schuitemaker a leading role in the agricultural as well
as in the public sector. In both sectors, Schuitemaker has
Firma SERAFIN P.U.H. zajmuje się dystrybucją innowacyjnych
maszyn oraz urządzeń w branży budowlanej, ogrodowej,
zbożowej i leśnej. Działa na polskim rynku od 2005roku i
prężnie rozwija się. SERAFIN P.U.H. jest przedstawicielem i
współpracuje z: MEPU Finlandia - producent suszarni porcjowych przejezdnych i stacjonarnych dla zbóż i nasion, silosów
kwadratowych skręcanych DAMAS Dania - producent maszyn
i urządzeń do czyszczenia i sortowania zbóż i nasion. Damas
dostarcza kompletne linie dla nasiennictwa jak i pojedyncze
maszyny o wydajnościach od 3 do 300 t/godz. JE-MA Dania
- producent maszyn i urządzeń do transportu poziomego i
pionowego zbóż. SUPERTECH Dania - producent doskonałych
testerów wilgotności ziarna jak i sond do pomiaru temperatury w magazynach płaskich oraz systemów do pomiaru i
kontroli temperatury w silosach. CROCUS Dania - producent
podnośników kubełkowych i przenośników taśmowych oraz
łańcuchowych do zbóż z założeniem dużych wydajności,
CROCUS produkuje również kolumny suszarnicze daszkowe
jak i kompletne suszarnie zbożowe o dużej wydajności. Digga
Australia – producent i eksporter przekładni planetarnych oraz
urządzeń do robót ziemnych.
Stoisko: D 294
95
Spis wystawców
List of exhibitors
P.W. Serwis-Centrum Sp. z o.o.
ul. Toruńska 137
85-831 Bydgoszcz
tel.: +48 52 346 42 81 / 82
fax: +48 52 362 94 47
e-mail: [email protected]
www.polanes.com.pl
tel.: +48 76 746 73 00
fax: +48 76 746 73 01
e-mail: [email protected]
www.sf-filter.pl
Stoisko: F 475
Serwis – Sklep Alternatorów i Rozruszników
Stanisław Osiński
Międzyrzecze Górne 552
43-392 Międzyrzecze Górne
tel.: +48 33 822 40 84
tel.: +48 33 815 30 06
tel./fax: +48 33 818 30 64
kom.: +48 500 222 496
kom.: +48 608 670 706
kom.: +48 508 045 175
e-mail: [email protected]
www.alternatory-rozruszniki.pl, www.osinskiartur.pl,
www.prestolite.com.pl
Od 23 lat specjalizujemy się w regeneracji alternatorów
i rozruszników (również w sprzedaży nowych) oraz w
sprzedaży części zamiennych do tych podzespołów. Dotyczy
to wszystkich typów samochodów osobowych, ciężarowych,
autobusów, maszyn, ciągników rolniczych. koparek. ładowarek, dźwigów, agregatów, wózków widłowych, thermokingów,
łodzi, prototypów i innych. Posiadamy części producentów
renomowanych firm europejskich, japońskich i amerykańskich, tj. BOSCH, VALEO, DENSO, HITACHI, MITSUBISHI,
ISKRA (LETRIKA), PRESTOLITE LEECE-NEVILLE. Prowadzimy
również sprzedaż cewek gaszenia firmy WOODWARD. Experci
w naszych biurach i warsztatach znają nazwy i numery seryjne wszystkich części co pozwala nam szybko odpowiedzieć
na zapytanie klientów. Mówimy po angielsku a nasz sklep
internetowy wysyła części na cały świat.
We have over 23 years’ experience in the regeneration of
alternators and starters. Apart from the professional service we
also sell new components and replacement units which include
all of the top brands: BOSCH, VALEO, DENSO, HITACHI, MITSUBISHI, ISKRA (LETRIKA), PRESTOLITE LEECE-NEVILLE. Our
knowledge, service and stock capabilities apply to all types of
cars, trucks, buses, agricultural tractors, machinery, excavators,
loaders, cranes, electric, aggregates, forklift trucks, thermo
kings, boats, prototypes, and more. We also offer Woodward’s
shutdown solenoids. Experts in our office and workshop know
each and every make of starter motor and alternator by part
number and will ensure a fast solution to your enquiry. We speak
English and our internet shop ships goods worldwide.
SF-Filter jest największym dostawcą filtrów i wkładów
filtracyjnych stosowanych we wszystkich branżach. W
naszych magazynach znajdują się filtry marki SF oraz innych,
uznanych na świecie producentów. Są to filtry: powietrza,
oleju, paliwa, hydrauliczne, cieczy, sprężonego powietrza,
wentylacji i klimatyzacji.
SF-Filter is a greatest supplier of all kinds of filters practical
contributions in all lines. In our stores are found SF brand
filters and other, recognized manufacturers. Those are filters
of air, oil, fuels, hydraulic, different liquid, compressed air,
ventilations and air-conditioning.
Stoisko: D 108
SG Equipment Leasing Polska Sp. z o.o.
ul. Marszałkowska 111
00-102 Warszawa
tel.: +48 22 528 4600
fax: +48 22 528 4611
e-mail: [email protected]
www.sgef.pl
Nasza oferta dla Klientów z branży agro to: pożyczka, pożyczka ze wsparciem unijnym (PROW), leasing. Udział własny już
od 0%. Okres finansowania aż do 8 lat. W przypadku robotów
udojowych aż do 10 lat! Raty ustalane indywidualnie płatne:
miesięcznie, kwartalnie, półrocznie lub sezonowo.
Our offer for the agricultural Customers includes: loan, loan
with the EU support (PROW), leasing. Down payment from
0%. Tenor of the contract up to 8 years. For milking robots
up to 10 years! Individually determined installments paid:
monthly, quarterly, semiannually or seasonally.
Stoisko: E 454
Sial W. Kimber, B. Kimber, H. Kimber Spółka Jawna
ul. Boguchwały 1
71-531 Szczecin
tel.: +48 91 421-16-50
fax: +48 91 421 15 05
e-mail: [email protected]
www.sial.pl
Stoisko: E 594
Stoisko: F 144
Siemens Finance Sp. z o.o.
ul. Żupnicza 11
03-821 Warszawa
tel.: +48 22 870 86 46
fax: +48 22 870 86 89
e-mail: [email protected]
Stoisko: B 178
SF-FILTER Sp. z o.o.
ul. Towarowa 10
59-300 Lubin
96
S
vers, Bale unrollers, Front loading machines, Bale shredders,
Disc mowers, Rakes, Conventional square balers, Slurry tankers, Fertilizer spreaders, Manure spreaders, Grain crushers,
Trailers, Multi body system, PTO Shafts.
Silotech Komorowski Sp. j.
Daleszynek 7
64-423 Lubosz
fax: +48 61 291 01 92
kom.: +48 665 403 000, 725 474 282
e-mail: [email protected]
wwww.silosy.net.pl
Stoisko: C212
Stoisko: D 426
SIMENA Spółdzielnia - Zakład Pracy Chronionej
ul. Gen. Fr. Kleeberga 10
21-300 Radzyń Podlaski
tel.: +48 83 352 84 10
fax: +48 83 352 84 10 wew. 306
e-mail: [email protected]
www.simena.com.pl
Wytwórnia Sit i Naprawa Maszyn Czyszczących
inż. Roman Leszczyński
ul. Wiosny Ludów 29
62-330 Nekla
tel./fax: +48 61 438 60 91, 61 438 64 87
e-mail: [email protected]
www.sitamet.pl
Oferujemy szeroki asortyment części elektrotechnicznych
do ciągników rolniczych i pojazdów specjalistycznych.
Produkujemy czujniki temperatury, wyłączniki wskaźnika
ciśnienia oleju, przyciski sygnału i rozrusznika, wyłączniki
hydrauliczne światła STOP oraz mechanizmy napędowe
wycieraczek kabin ciągników rolniczych i budowlanych.
W naszej ofercie posiadamy również uchwyty wiertarskie
oraz ubrania robocze i ochronne. Współpracujemy z
największymi dystrybutorami oraz hurtowniami z terenu
Unii Europejskiej, a także z Serbii oraz Bośni i Hercegowiny.
W trosce o wysoką jakość naszych wyrobów wdrożyliśmy
System Zapewnienia Jakości ISO nadzorowany przez firmę
TUV Rheinland.
Usługi w zakresie napraw bieżących i remontów kapitalnych
maszyn produkcji krajowej i zagranicznej do czyszczenia i
sortowania zbóż oraz nasion. Sprzedaż używanych maszyn
czyszczących i wialni z pełną gwarancją. Produkcja: sita
do wszystkich typów maszyn czyszczących (krajowych i
zagranicznych), sita do wszystkich typów wialni, sita do
suszarni bębnowych i podłogowych, sita do młynów i śrutowników bijakowych, sita żaluzjowe i otworowe do wszystkich
typów kombajnów zbożowych, części zamienne do maszyn
czyszczących, ramy stalowe i drewniane do sit, sita i
bijaki do śrutowników MM i OMT, podnośniki czerpakowe,
kubełki do podnośników wg wzoru zamawiającego, ekrany
dźwiękochłonne, szafy bhp, skrzynki metalowe, pojemniki do
zbioru szparagów, perforacja blach, kompleksowa obróbka
plastyczna blach.
We offer a wide range of tractor’s parts such as: temperature sensor, oil pressure switch, hydraulic break switch,
horn button and starter button, moreover, tractor’s and
building tractor’s windscreen wiper mechanism as well as
drill chuck. Our company for many years cooperates with
the biggest and well known distributors and wholesalers
from Poland as well as from Czech Republic, Slovakia,
Serbia, Bosnia-Herzegovina, Croatia and foremost Germany.
In the interests of the highest quality of all our goods we
have implemented ISO Quality System Cerification by TÜV
Rheinland company.
Stoisko: F 135
SIPMA S.A.
ul. Budowlana 26
20-469 Lublin, Polska
tel.: +48 81 744 50 71
e-mail: [email protected]
www.sipma.pl
Nasza oferta: Prasy zwijające, Owijarki bel, Wózki do bel,
Ładowacze czołowe, Rozdrabniacze bel, Kosiarki dyskowe,
Zgrabiarki, Prasy kostkujące, Wozy asenizacyjne, Rozsiewacze nawozów mineralnych, Rozrzutniki obornika, Zgniatacze
ziarna, Przyczepy rolnicze, System nadwozi wymiennych,
Wały przegubowo-teleskopowe.
Stoisko: D 430
Wytwórnia Sit „Sitono”
Krzysztof Nowakowski
ul. Zawodzie 9
62-330 Nekla
tel.: +48 61 438 60 69
fax: +48 61 438 65 72
e-mail: [email protected]
www.sitono.pl
Stoisko: C 386
SKOTAREK Produkcja Maszyn Rolniczych
i Części Jerzy Skotarek
ul. Dworcowa 15
56-200 Góra
tel.: +48 65 543 35 64
fax: +48 65 543 44 08
e-mail: [email protected]
www.skotarek-maszyny.pl
Stoisko: C 198
Our offer: Round balers, Bale wrapping machines, Bale mo-
97
Spis wystawców
List of exhibitors
Skraw-met
Wąwelnica 18
72-002 Dołuje
tel.: +48 91 311 88 50, +48 91 431 84 75
fax: +48 91 311 88 51
kom.: +48 601 784 841
Hydraulika Siłowa SKRAW-MET jest wiodącym producentem
siłowników hydraulicznych, które są stosowane w maszynach
rolniczych, komunalnych, leśnych, budowlanych, górniczych,
oraz wszelkiego rodzaju podnośnikach, dźwigach i wózkach
widłowych. Firma SKRAW-MET zatrudnia ponad 150 osób.
Firma posiada Certyfikat Zarządzania Jakością ISO 9001:2009
oraz certyfikat górniczy INOVA.
Company SKRAW-MET Hydraulic Cylinders is leading manufacturer of hydraulic cylinders which are used in agricultural
machines, municipal machines, forestry machines, construction machines, mining machines, cranes, and fork-lifts. The
company employees 150 people. Skraw-Met is certified with
ISO 9001:2009 and by INOVA (mining certificate).
SOLAN T. CZECH, Ł. CZECH SP.J.
J.Porazińskiej 12
20-448 Lublin
tel.: +48 81 751 07 85
fax: +48 81 751 05 51
Firlej Grzegorz
kom.: +48 504 267 774
e-mail: [email protected]
www.solan.lublin.pl
„Solan” jest firmą prywatną, której początki sięgają 1981
roku. Obecnie firma oferuje bogaty asortyment urządzeń rolniczych takich jak sadzaki karuzelowe, sadzarki chwytakowe
(w tym szkółkarskie i leśne), pielniki międzyrzędzi, gwiazdy
do pielenia w rzędzie między roślinami, dozowniki nawozów
przystosowane do sadzarek i pielników. Cechuje nas duża
elastyczność działania. Pomimo szerokiej oferty zdecydowana
większość maszyn dostępna jest od ręki, realizujemy również
zlecenia nietypowe. Nasz system wartości to uczciwość,
doskonałość, która znajduje odbicie w profesjonalizmie
naszych pracowników. Gotowi jesteśmy służyć konsultacjami
i wsparciem technicznym we właściwym doborze maszyn.
Stoisko: D 78
Societe Promodis (Spółka Akcyjna Spółdzielnia)
oddział w Polsce
ul. Sierpecka 10
09-402 Płock
tel.: +48 600 036 306
fax: +48 24 26 77 331
e-mail: [email protected]
www.promodis.pl
Promodis to sieć 140 firm ze Zjednoczonej Europy,
stanowiących 410 punktów sprzedaży. W Polsce działa
dziewięciu udziałowców Promodis: Rolserwis Płock, Gravit
Lublin, Agroskład Ujazd, Ambroży Bierutów, Pilar-tech
Posądza, Toral Gostyń, Agrotechnik Stawiski, Agroperfekt
Kisielice i HBT Kroczyce. Każdy z udziałowców Promodis posiada dwa koncepty: Centrum Maszyn oraz Sklep
Samoobsługowy Promodis.
Promodis est le 1er réseau européen, de plus de 140 distributeurs et près de 410 bases. Notre réseau polonais compte
9 sociétaires Promodis: Rolserwis Płock, Gravit Lublin,
Agroskład Ujazd, Ambroży Bierutów, Pilar-tech Posądza,
Toral Gostyń, Agrotechnik Stawiski, Agroperfekt Kisielice et
HBT Kroczyce. Chaque sociétaire du réseau propose deux
concepts: Centre Matériel et Libre Service Promodis.
Stoisko: C 521
Solideal Polska S.A.
ul. Trakt Brzeski 35
05-077 Warszawa – Wesoła
tel.: +48 22 425 37 10
fax: +48 22 783 35 82
www.solideal.pl |
SOLIDEAL POLSKA S.A. jest oddziałem grupy Camoplast
Solideal, światowego lidera w projektowaniu i produkcji najwytrzymalszych i odpornych na zużycie opon, felg i gąsienic dla
przemysłu. Oferta firmy Solideal jest kompleksowa i specjalizuje
się w segmencie ogumienia przemysłowego, dlatego kładzie
ogromny nacisk na rozwój tego produktu co wpływa na jakość.
SOLIDEAL POLSKA S.A. is a branch of the Camoplast Solideal
group, of world leader in designing both the toughest productions and wear-resistant tires, wheel rims and trucks for the
industry. The offer of the Solideal company is comprehensive
and specializes in the section of industrial tires, therefore a
huge pressure on the development of this product is putting
what influences the quality.
Stoisko: E 128
Stoisko: B 180
Sparex Polska Sp. z o.o
ul. Ogrodnicza 13, Janikowo
62-006 Kobylnica
98
S
Bona and Grazis, bean - Undira and Arkana, beetroot Turkus
and carrot - Fama F1 and Alfa F1.
Tel. +48 61 816 19 37
fax: +48 61 816 29 22
www.sparex.com
Stoisko: B 363
Sparex Polska Sp. z o.o. należy do międzynarodowej grupy
Sparex składającej się z 18 oddziałów na świecie. Zajmujemy
się dystrybucją części zamiennych do maszyn rolniczych
zachodnich producentów.
Sparex Poland Sp. z o.o. belongs to the international Sparex
Group consisting of 18 branches in the world. We distribute
spare parts for agricultural machinery western manufacturers.
Stoisko: E 115
SPawex Sławomir Prażanin
ul. Jana Pawła II 22
08-106 Zbuczyn
tel./fax: +48 25 642 03 87
e-mail: [email protected]
Firma Spawex produkuje osprzęt do ładowaczy czołowych:
chwytaki bel, widły do obornika, widły-krokodyl, widły do
palet, łyżki do materiałów sypkich, pługi odśnieżne, przetrząsarko-zgrabiarki, przenośniki bel, zgarniacze. Gwarantujemy
przystępne ceny i dobrą jakość.
The company SPAWEX produces accessories for front
loaders: bale grabbers, manure forks, crocodile forks, pallet
forks, buckets for bulk materials, snow plough, rake/tedder,
bale transporter, plough-rubber shields. We guarantee attractive prices and good quality.
Stoisko: A 6
SPÓJNIA Hodowla i Nasiennictwo Ogrodnicze Sp. z o.o.
Nochowo, ul. Lipowa 22
63-100 Śrem
tel.: +48 61 283 56 55
fax: +48 61 283 74 35
e-mail: [email protected]
www.nasiona-warzyw.pl
Oferujemy szeroki asortyment nasion warzyw, kwiatów i
ziół dla producentów i działkowiczów. Produkty naszej firmy
odznaczają się wysoką jakością, za którą wielokrotnie zostały
nagrodzone m/innymi godłem „Najlepsze w Polce” oraz
„Jakość Roku”. Polecane nowości: ogórek Avatar F1 i Słowiański F1, rzodkiewka Bona i Grazis, fasola Undira i Arkana,
burak Turkus oraz marchew Fama F1 i Alfa F1.
We offer a wide range of vegetable, flower and herb seeds
for producers and plot owners. Products from our company
are characterised by their high quality, for which they
received numerous awards, including logos “The best in
Poland” and “Quality of the Year”. Recommended new
products: cucumber - Avatar F1 and Słowiański F1, radish -
SPÓŁDZIELNIA INWESTYCJI I BUDOWNICTWA
W ŁOWICZU
ul. Kaliska 103
99-400 Łowicz
tel.: +48 46 837 32 79
fax: +48 46 837 47 98
e-mail: [email protected]
strona: www.sib.lowicz.pl
Producent wyrobów betonowych. Betonowe podłogi rusztowe
do chlewni i obór. Ruszta dla trzody chlewnej, macior, i
prosiąt. Ruszta dla bydła. Producent okien inwentarskich.
Okna PCV do chlewni, obór, piwnic i garaży
Stoisko: F 465
Stacja Hodowli i Unasieniania Zwierząt Sp. z o.o. w
Bydgoszczy
ul. Zamczysko 9a,
85-868 Bydgoszcz
tel.: +48 52 328 03 01
fax: +48 52 328 03 17
e-mail: [email protected]
www.shiuz.pl
Jesteśmy wiodącą firmą w Polsce zajmującą się unasienianiem bydła i trzody. Oferujemy: najlepszą polską genetykę na
światowym poziomie, buhaje poprawiające cechy produkcyjno-pokrojowe u potomstwa, nasienie knurów ras polskich i
zagranicznych, wyniki potwierdzone w polskich warunkach,
fachową pomoc naszych specjalistów w doborze buhajów,
bezpieczeństwo weterynaryjne, suplementy diety wspomagające rozród zwierząt, obrót zwierzętami. Zapraszamy do
współpracy inseminatorów, hodowców indywidualnych oraz
przedstawicieli terenowych.
We are the leading company in Poland involved in livestock
insemination in Poland. We offer: best Polish genetics on international level, sires improving production and conformation
traits in progeny, semen of Polish and foreign boars, results
proven in Polish environment, professional help and advisory
service of our specialists, veterinary safety, diet supplements
for better animal reproduction results, livestock trade. We
invite to cooperation AI technicians, individual farmers and
sales representatives.
Stoisko: D 557
99
Spis wystawców
List of exhibitors
rvices are concerned it has a substantial experience. Different
types of containers – tanks for transport and storage are our
basic products.
STAL IMPEX Sp. z o.o.
ul. Łukasiewicza 49
38-400 Krosno
tel.: +48 885 204 200, 885 204 201
fax: +48 13 42 015 27
e-mail: [email protected]
www: www.krosagro.com
Stoisko: F 245
Producent tuneli foliowych, szklarni, namiotów garażowych
i magazynowych (do 14 metrów szerokości), ogrodzeń
wykonywanych innowacyjną metodą bezspawową oraz rur
stalowych zgrzewanych i profili otwartych o grubościach
ścianki od 0,8 do 3,0mm.
Stoisko: D 542
Firma STALTECH specjalizuje się w produkcji maszyn rolniczych. W ofercie posiadamy: pługi, agregaty podorywkowe,
głębosze, agregaty talerzowe uprawowe (3m, 4m, 5m, 6m)
oraz agregaty talerzowe uprawowo siewne.
Manufacturing „STALTECH” specialise in manufacturing
agricultural machines. We have in our offert ploughs, stubble
cultivators, subsoilers, drill harrow (3m, 4m, 5m, 6m) and
cultivating drill machines.
Stalmach Marek Machowski
ul. Sieniutowa 8a
63-760 Zduny
tel.: +48 62 721 52 53
kom.: +48 697 331 088
e-mail: [email protected]
www.stalmach.com.pl
Stoisko: B 181
Zajmujemy się projektowaniem, produkcją i montażem konstrukcji stalowych. Dysponujemy nowoczesnymi maszynami
do produkcji i montażu, fachową i zaangażowaną kadrąoraz
własnym biurem projektowym. Specjalizujemy się w dostarczaniu pod klucz takich obiektów jak: budynki przemysłowe,
hale produkcyjne, obiekty magazynowe, obiekty sportowe,
centra handlowe i targowe, obiekty rolnicze: stodoły, obory,
kurniki, magazyny i inne, obiekty specjalnego przeznaczenia.
We design, manufacture and assemble stell constructions.
We have modern machines for production and assemble,
proffessional and involved workers and our own design office.
Our specialization is providing objects like: industrial buildings,
sport objects, trade centers and market places, magazines,
farm objects: barns, byres, hen houses, magazines and
others, special destination objects.
Stoisko: D 545
STALMECH
Nowa Biała 33
09-411 Biała
tel.: +48 24 367 10 08, 24 367 10 06,
24 267 74 08, 24 262 78 63
fax: +48 24 367 33 00
e-mail: [email protected]
www.stalmech.com.pl
Firma Stalmech istnieje od 1989 r. W zakresie oferowanych
usług ma znaczące doświadczenie. Nasz podstawowy produkt to
różnego typu kontenery-pojemniki transportowo - magazynowe.
Stalmech company has existed since 1989. As far as the se-
100
Staltech
Grzegorz Dobrzański
ul. Piotrkowska 5
97–570 Przedbórz
tel./fax: +48 44 781 20 72
kom: +48 793 691 130
e-mail: [email protected]
www.staltech.biz
STANIMPEX Maciej Packiewicz
Gorszewice 30
64-530 Kaźmierz
tel.: +48 61 291 81 59
fax: +48 61 295 92 48
kom.: +48 602 157 653
kom.: +48 602 852 864
e-mail: [email protected]
www.stanimpex.pl
Firma STANIMPEX zajmuje się produkcją opryskiwaczy na
podzespołach znanych światowych firm. W swojej ofercie posiadamy opryskiwacze polowe przyczepiane od 1000 do 5000 litrów
z belką od 12m do 24m. Prowadzimy również sprzedaż opryskiwaczy sadowniczych, maszyn rolniczych i części zamiennych.
The company STANIMPEX produces sprinklers of subassemblies from renowned global companies. Our offer includes
mounted field sprinklers of 1000 to 5000 litres capacity with a
beam of a length from 10 to 24 meters. We also sell orchard
spronklers, agricultural machines and spare parts.
Stoisko: C 57
Steelpress Sp. z o.o.
ul. Powstańców Wlkp. 48
62-030 Luboń
tel.: +48 61 899 43 83
www.steelpress.eu
S
Jesteśmy polskim producentem metalowych części do
przyczep. Nasze wyroby znajdują zastosowanie także w
wózkach sadowniczych, silosach, kotłach czy kompresorach.
Stale rozszerzamy naszą ofertę, stawiając na wysoką jakość i
długą żywotność produktu. 45 lat doświadczenia i współpraca
z wiodącymi producentami przyczep w Europie daje nam w
branży pozycję lidera. Zapraszamy do współpracy!
We are a Polish manufacturer of metal parts for trailers.
Our products are also used in fruit trucks, silos, boilers and
compressors. We are constantly expanding our offer, putting
an attention on high quality and long product life. 45 years
of experience and cooperation with bigest manufacturers of
trailers in Europe gives us a leading position in the market.
We invite you to cooperation! 62-030 Luboń, 48 Powstańców
Wlkp. Street, tel.: +48618994383 www.steelpress.eu
Stoisko: E 121
CNH Polska Sp. z o.o.
ul. Otolińska 25
09-407 Płock
tel.: +48 24 267 96 79, 24 267 97 16
fax: +48 24 267 97 15
fax: +48 61 875 95 73
e-mail: [email protected]
www.ssdpoznan.pl
Stomil Sanok S.A. jest renomowanym na świecie producentem pasów klinowych. Posiada w swojej ofercie produkt„Harvest Belts®” – pasy rolnicze do kombajnów produkcji
zachodniej. „Harvest Belts®”jest to optymalna alternatywa do
oryginalnych pasów klinowych montowanych w kombajnach.
Blisko 80-cio letnie doświadczenie w produkcji wyrobów z
gumy oraz system zarządzania jakością gwarantują doskonałą
jakość wyrobów produkowanych przez Stomil Sanok S.A.
StomilSanok S.A. is a well-known manufacturer of V-belts.
One of our products is Harvest Belts – agricultural V-belts for
western models of combines harvester. Harvest Belts is optimal alternative for original parts set up in combines. Nearly
80 years of experience in rubber components production and
quality management system provide excellent quality of goods
produced by StomilSanok.
Stoisko: D 102
Stoisko: D 284
STOWARZYSZENIE POLSKI ZIEMNIAK
Jadwisin, ul. Szaniawskiego 15
05-140 Serock
Biuro: Strzekęcino 11
76-024 Świeszyno
tel.: +48 94 316 12 95
fax: +48 94 316 13 77
e-mail: [email protected]
www.polskiziemniak.pl
STILL Polska Sp. z o.o.
ul. Składowa 11, Żerniki
62-023 Gądki
tel.: +48 61 668 61 00
fax: +48 61 668 61 89
e-mail: [email protected]
www.still.pl
STILL jest wiodącym dostawcą inteligentnego sterowania
logistyki wewnętrznej. Firma znana jest na całym świecie
z konstruowania i produkcji wysokiej jakości urządzeń do
transportu poziomego z napędem elektrycznym, Diesla i gazowym. W naszej ofercie znajdują się nowe i używane wózki:
czołowe z napędem spalinowym lub elektrycznym; z zakresu
techniki magazynowej; platformowe i ciągniki; do zastosowań
specjalnych oraz systemy regałowe.
STILL is the leading supplier for intelligent control of intralogistics. The company is known worldwide for designing and
manufacturing of high quality and innovative equipment. In
our offer there are new and used: new and used front forklift
trucks with combustion or electric drive; warehouse handling
equipment; platform trucks and tractors; trucks for special
purposes.
Zasadniczym celem działalności Stowarzyszenia Polski Ziemniak
jest integrowanie branży ziemniaczanej dla podnoszenia rangi
produkcji i spożycia ziemniaka, poprzez wspieranie rozwoju
rynku krajowego i eksportu, rozwoju przetwórstwa, tworzenie
podstaw do unowocześnienia technologii produkcji i przechowalnictwa oraz upowszechnianie postępu biologicznego.
The principal aim of activity of The Association Polish Potato
is integrating the potato trade for raising of rank of production
and the consumption of potato, through support the development of national market and the export, development of
processing, creating the bases to modernization of technology
of production and the storage as well as the disseminating the
biological progress.
Stoisko: hala 9
Stoisko: C 534
STOMIL SANOK - Dystrybucja Sp. z o.o.
ul. Gnieźnieńska 99, Bogucin
62-006 Kobylnica
tel.: +48 61 875 97 93/94
SUMERA MOTOR Sp. J.
ul. Krakowska 5
34-120 Andrychów
tel.: +48 33 870 40 60
fax: +48 33 870 40 61
e-mail: [email protected]
www.sumeramotor.pl
101
Spis wystawców
List of exhibitors
Firma Sumera Motor jest producentem agregatów prądotwórczych o mocy 3-400kVA. Rozwinięta sieć punktów dystrybucyjnych, rozmieszczona we wszystkich regionach Polski,
spowodowała że jesteśmy czołowym dostawcą agregatów
prądotwórczych napędzanych z WOM ciągnika rolniczego do
gospodarstw rolnych. Specjalizujemy się również w zaawansowanych technologicznie agregatach spalinowych, które
uruchamiają się automatycznie przy zaniku napięcia z sieci.
Oferujemy serwis wszystkich wyprodukowanych przez naszą
firmę agregatów. Zapraszamy do współpracy.
Sumera Motor is a maker of generating sets of 3 – 400 kVA.
Our well-developed distribution network, located in all the
regions of Poland, resulted that we are a leading supplier of
generating sets driven by tractor PTO for agriculture farms.
We also specialize in advanced stand-by engine-driven generating sets that start up automatically in case of mains failure.
We provide servicing of all our generating sets.
kopaczek, sortowników, podajników, transporterów itp. oraz
wiele części zamiennych do wyżej wymienionych maszyn.
For almost 40 years our company has been producing
conveyers for potato harvesters. We offer a wide range of
conveyers, of various types, dimensions and configurations
for: potato, beet, onion, carrot, etc. harvesters, produced in
Poland and abroad; diggers, sorters, feeders, transporters,
etc., and many spare parts for above-mentioned machines.
Stoisko: F 146
Stoisko: C 596
ZAP Sznajder Batterien S.A.
ul. Warszawska 47
05-820 Piastów
tel.: +48 22 723 60 11
e-mail: [email protected]; [email protected]
www.zap.pl; www.sznajder.pl
Stoisko: F 464
Od 1925 r. producent akumulatorów kwasowych, rozruchowych. Od 2002 r. firma zaliczana jest do grupy światowych
producentów, wykorzystujących metodę cięto-ciągnioną do
produkcji kratki ołowiowej (expanded metal). Laureat XXI
edycji godła Teraz Polska za akumulatory srebrowo-wapniowe
serii SILVER. Na wystawie: akumulatory 12 V od 35 Ah do
230 Ah, 6V od 165 do 215 Ah.
SUNDS ALFA A/S member of IBF Group
ul. Kościuszki 21
59-700 Bolesławiec
tel.: +48 75 732 40 31
fax: +48 75 732 40 34
e-mail: [email protected]
www.ibf.pl
Manufacturer of starter acid batteries since 1925. Counted
among world producers of lead grid in expanded metal technology. Awarded in 2011 in the prestigious emblem Poland
Now for silver-calcium car batteries od Silver range. ZAP
offers 12 V batteries with capacity ranging from 35 Ah to 230
Ah, 6V batteries with capacity of 165 Ah to 215 Ah.
SWIMER
ul. Wielki Rów 40a
87-100 Toruń
tel.: +48 56 681 47 22
e-mail: [email protected]
www.wlasnabazapaliw.pl
Stoisko: D 81
Firma SWIMER zajmuje się dystrybucją i serwisem zbiorników
przeznaczonych do bezpiecznego magazynowania i dystrybucji Oleju Napędowego, BioDiesel, AdBlue. W naszej ofercie
znajdą Państwo szeroką gamę zbiorników ze stali i polietylenu,
wyposażonych w układ dystrybucyjny, w wersji stacjonarnej
jak i mobilnej, jak również węże, pistolety, przepływomierze
oraz smarownice: pneumatyczne, nożne, ręczne
Stoisko: E 120, C 209, E 445
SZARAFIN
ul. Spacerowa 2
83-220 Skórcz
tel./fax: +48 58 582 43 70, 582 42 55
kom.: +48 783 876 035
www.szarafin.com.pl
Świtała Tadeusz P.P.H.U. „TAD-LEN”
Zielona Wieś 55
63-900 Rawicz
tel.: +48 65 545 12 21, 65 546 95 66
e-mail: [email protected]
www.tad-len.pl
Oferujemy-Opryskiwacze polowe i sadownicze od 300l do
4000l, pompy przeponowe do opryskiwaczy: 60l, 100l, 140l,
200l, części zamienne do pomp i opryskiwaczy, maszyny
rolnicze: świdry, agregaty uprawowe, kosiarki rotacyjne.
We offer - Field and orchard sprayers, from 300L to 4000L.
- Membrane pumps for sprayers: 60L, 100L, 140L, 200L, Spare parts for pumps and sprayers; - Agricultural machines:
drills, cultivating units, rotary mowers
Stoisko: C 195
Przenośniki do kombajnów ziemniaczanych wytwarzane są w
naszym przedsiębiorstwie od prawie 40 lat. Oferujemy szeroką gamę przenośników pod względem rodzajów, wymiarów
i konfiguracji do: kombajnów zbierających: ziemniaki, buraki,
cebule, marchew itp. Produkcji krajowej i zagranicznej. Do
102
T
TASOMIX Sp. z o.o.
Wytwórnia Pasz i Koncentratów
Biskupice Ołoboczne, ul. Środkowa 89
63-460 Nowe Skalmierzyce
tel.: +48 62 767 67 67
e-mail: [email protected]
www.tasomix.pl
TALEX LESZEK JAWORSKI I WSPÓLNICY
SPÓŁKA JAWNA
ul. Zwycięstwa 33
77-141 Borzytuchom
tel.: +48 59 821 13 26
fax: +48 59 821 19 06
e-mail: [email protected]
www.talex-sj.pl
Stoisko: B 342
Stoisko: B 185
Tama Polska Sp. z o.o.
ul. Polskiej Organizacji Wojskowej 12a
98-200 Sieradz
tel.: +48 43 822 04 52
fax: +48 43 822 04 53
e-mail: [email protected]
www.tama-polska.pl
Tama Polska – oddział TamaPlastic Industry, największego na
świecie producenta siatek rolniczych do belowania, oferuje
najwyższej jakości: siatki rolnicze standardowe: Astra, Rolnet,
Ecobull, Covernet – 2000m i 3000m; siatki rolnicze Premium:
Pro-Tec Edge to Edge 3600m, Marathon 2800m i 4200m
oraz Tamanet 4500m – najdłuższa siatka na świecie! sznurek
rolniczy: typ 130, 500, 750.
Tama Polska - division of Tama Plastic Industry, the world's
largest manufacturer of agricultural baling netwrap, offering
the highest quality: standard nets: Astra, Rolnet, Ecobull,
Covernet - 2000m and 3000m; premium nets: Pro-Tec Edge
to Edge 3600m, Marathon 2800m and 4200m, Tamanet
4500- the longest on the market! baler twine: type 130, 400,
500, 750.
Stoisko: C 502
TEAM OF AGRA Sp. z o.o.
ul. Zachodnia 4
62-090 Cerekwica
tel.: +48 604 908 340
e-mail: [email protected]
www.biogazownierolnicze.pl
Team of Agra Sp. z o.o. – spółka nonprofit działająca w
obszarze rolnictwa i energii odnawialnej. W ramach swojej
działalności firma utworzyła klaster skupiający firmy związane
z budową i projektowaniem biogazowni rolniczych. Wkrótce
spółka rozpocznie realizację pokazowej biogazowni rolniczej
250 kW w Wielkopolsce o której poinformuje na łamach
swojego portalu www.biogazownierolnicze.pl.
Team of Agra Sp. z o.o. – company is working in the field
of agriculture and renewable energy. As part of its activity
of company is cluster of companies focused on building
and designing biogas plants. Soon the company will start of
building demonstration 250 kW biogas plant in Wielkopolska
about what company will communicate by website www.
biogazownierolnicze.pl.
Stoisko: D 222
TECH-KOM Przemysław Laskowski
Żabikowo 1
63-000 Środa Wielkopolska
tel.: +48 61 285 42 97
fax: +48 61 285 60 98
e-mail: [email protected]
www.tech-kom.pl
Stoisko: F 305
Targi AGROTECH
Międzynarodowe Targi Techniki Rolniczej AGROTECH
Organizator: Targi Kielce S.A.
ul. Zakładowa 1
25-672 Kielce
tel.: +48 41 365 12 30
fax: +48 41 365 13 10
e-mail: [email protected]
www.agrotech.pl, www.targikielce.pl
Stoisko: hala 30
Targowa Oficyna Wydawnicza Magdalena Kunikowska
Płomienna 5c/12
60-392 Poznań
tel./fax: +48 61 830 92 48
e-mail: [email protected]
www.targoweabc.pl
Stoisko: hala 4
Techmet A.M.M.Z. Juzwa Spółka Jawna
ul. Mała 10
62-200 Gniezno
tel./fax: +48 61 428 24 18
e-mail: [email protected]
www.techmet.pl
Stoisko: C 530
Techmot Sp. z o.o.
ul. Warszawska 19
16-070 Choroszcz
tel.: +48 85 719 31 82
fax: +48 85 719 13 11
e-mail: [email protected]
www.techmot.com.pl, shop.techmot.com.pl
103
Spis wystawców
List of exhibitors
W ofercie firmy TECHMOT znajduje się bogaty wybór części
zamiennych i akcesoriów do ciągników i maszyn rolniczych
oraz budowlanych, samochodów ciężarowych i osobowych
(części do silników, aparatura paliwowa, turbosprężarki,
opony, akcesoria) oraz kompleksowe usługi diagnostyczne i
serwisowe Diesel, Common Rail, Turbo. Gwarantujemy wysoką jakość naszych produktów oraz profesjonalną obsługę
klientów.
In TECHMOT company offer there is a wide selection of spare
parts and accessories for tractors, agricultural and building
machinery, trucks and cars (engine parts, fuel equipment,
turbochargers, tires, accessories), as well as complex diagnostic and repair services - Diesel, Common Rail, Turbo. We
guarantee quality of our products and professional service.
Stoisko: D 105
TECHMOT Sp. z o.o.
ul. Konsularna 1
45-089 Opole
tel.: +48 77 441 77 34
fax: +48 77 456 97 73
e-mail: [email protected]
www.tech-mot.pl
Stoisko: A 320
Stoisko: C 520
TerraExim – Agroimpex Spółka z o.o.
Zakrzewo ul. Przemysłowa 20
62-070 Dopiewo
tel./fax: +48 61 875 42 33
e-mail: [email protected]
www.terraexim.pl
Kompleksowe wyposażenie budynków inwentarskich: Doradztwo - projekty technologiczne – montaż – serwis. Systemy
wentylacji; systemy żywienia i pojenia; systemy zadawania
pasz; systemy usuwania gnojowicy; ruszta; jarzma porodowe,
kojce indywidualne; silosy; drabiny paszowe, przegrody
legowiskowe, wiązania, kojce dla cieląt. Energia ze słońca –
panele fotowoltaiczne: Instalacje fotowoltaiczne, dachowe i
naziemne.
Total solution for livestock buildings: Advisory - technological
project - assembly - service. Ventilation systems; feeding and
drinking systems; automatic feeders; straight flush slurry systems; slats; farrowing crates, individual crates; silos; racks,
stalls, cattle bindings. Solar Energy – Photovoltaic panels:
roof and ground photovoltaic plants
TEHNOS d.o.o. Žalec
Cesta ob železnici 1
3310 ŽALEC
SŁOWENIA
tel.: +386/3/713-30-50
fax: + 386/3/713-30-60
e-mail: [email protected]
www.tehnos.si
Stoisko: E 436
Firma Tehnos posiada ponad 30 lat doświadczenia w produkcji
maszyn rolniczych i nadal się rozwija. Nasze produkty
charakteryzują się solidną konstrukcją, dużą żywotnością
i funkcjonalnością, dzięki czemu stanowią niezbędne
wyposażenie każdego gospodarstwa. Nasze produkty są:
Kosiarki bijakowe – Profi, Kosiarki bijakowe – Light, Kosiarki
bijakowe boczne, Rozdrabniacze polowe, Kosiarki rotacyjne,
Kultywatorzy z siewnikiem, Kultywatorzy międzyrzędowe
dla uprawy kukurydzy, buraków cukrowych, kapusty, cebuli,
marchwi, sałaty i ziemniaków, Rozsiewacze nawozu, Sadzarki,
Kopaczki.
Tehnos is constantly upgrading 30 years of experiences and
know-how in agricultural production. Our products with its robust
construction, long lifetime and functionality present indispensable
machines for each farm. Our product range is: Flail Mowers –
Profi, Flail Mowers – Light, Lateral Flail Mowers, Field Shredders,
Rotary Mowers, Cultivators for corn, sugar beat, potato, other
plants, Fertilizer spreaders, Potato Planters and Diggers.
Stoisko: C 595
Terplast Sp. z o.o. Zakłady Przetwórstwa Tworzyw
Sztucznych
ul. Łokietka 8
98-200 Sieradz
104
tel.: +48 43 826 07 00
fax: +48 43 826 07 10
e-mail: [email protected]
www.terplast.com.pl
TEXA
ul. Babińskiego 4
30-393 Kraków
tel.: +48 12 263 10 12
e-mail:[email protected]
www.texapoland.pl, www.texapoland.pl
Lider sektora diagnostyki pojazdów; Jako jedyna firma oferuje
wielomarkowy sprzęt diagnostyczny NAVIGATOR TXT AGRI do
maszyn rolniczych z zaawansowanym oprogramowaniem w
j. polskim z zintegrowaną bazą danych technicznych. Ponadto
proponuje interfejs do diagnostyki tradycyjnej UNIPROBE oraz
stację do obsługi klimatyzacji dla sektora rolniczego.
The Leader of the automotive diagnostics, as the only one
company offers multi-brand interface which is a NAVIGATOR
TXT AGRI, dedicated for agricultural vehicles diagnosis. The
advanced software is available in polish language and it is
integrated to technical information data base. Moreover, Texa
offers UNIPROBE interface for the traditional electric diagnosis
and a/c recharging stations for agricultural sector.
Stoisko: C 53
T
TOOLMEX TRUCK Sp. z o. o.
ul. Metalowa 7 b
26-500 Szydłowiec
tel.: +48 48 617 48 06
fax: +48 48 617 48 05
e-mail: toolm[email protected]
www.toolmex-truck.com.pl
THYE LOKENBERG Polska Sp. z o.o.
ul. Osiedlowa 27
68-114 Tomaszowo
tel.: +48 68 360 61 99
fax: +48 68 360 62 99
e-mail: [email protected]
www.thye-lokenberg.pl
Betonowe podłogi rusztowe dla bydła; betonowe podłogi
rusztowe dla trzody; podciągi; zasuwy do kanałów. Betonowe
podłogi rusztowe produkujemy o różnych szerokościach
szczelin dostosowanych do wieku i wagi zwierzęcia. Obecnie
wprowadzamy nowość na rynku polskim – Drilling System,
czyli ruszta dla bydła o szerokości 50 cm i powierzchni
stąpania większej niż dotychczas – szerokość beleczki wynosi
13,1 cm.
TOOLMEX TRUCK – oficjalny importer wózków widłowych
HYUNDAI oferuje: WÓZKI WIDŁOWE: sprzedaż, serwis,
wynajem, osprzęty, skup wózków używanych. CZĘŚCI
ZAMIENNE: posiadamy w sprzedaży pełen asortyment
części zamiennych do wszystkich wózków widłowych.
REGAŁY MAGAZYNOWE: projektowanie, dostawa, montaż.
SZKOLENIA: operatorów i konserwatorów wózków widłowych. Naprawimy i wyremontujemy każdy wózek widłowy
za najniższą cenę!
Stoisko: E 433
D
r
o
TOOLMEX TRUCK the official importer of HYUNDAI forklift
trucks offers: FORKLIFT TRUCKS: sales, servicing, rental,
special equipment, spare parts. WAREHOUSE RACKS: design,
delivery, assembling. TRAINING: of forklift truck operators and
maintenance technicians. We will repair every forklift truck for
the lowest price!
w i a i n a t u r y
g à
z d r o
TOKO - Mlekomaty
ul. Księdza Londzina 65
43-246 Strumień
tel./fax: +48 33 852 30 02
e-mail: [email protected]
www.mlekomaty.org
Stoisko: C 375
Firma TOKO oferuje najwyższej, jakości automaty do bezpośredniej sprzedaży świeżego mleka. Jako czołowy dostawca
mlekomatów na rynku, firma gwarantuje fachową pomoc
i doradztwo w zakresie doboru odpowiedniego automatu,
załatwianiu formalności związanych z finansowaniem oraz
rejestracją urządzeń. Mlekomaty TOKO są pod każdym względem niezawodne, bezawaryjne i bardzo proste w obsłudze.
TOKO offers the highest quality machines for the direct sale
of fresh milk. As a leading supplier of milk vending machines
at the market, the company provides professional assistance
and advice in the selection of a suitable machine, completing
the formalities relating to the financing and registration of devices. TOKO machines are in all respects reliable, trouble-free
and very easy to use.
TECHNICZNO – HANDLOWA OBSŁUGA ROLNICTWA
”TORAL” Elżbieta Krupa
ul. Poznańska 65
63-800 Gostyń
tel./fax: +48 65 575 16 05/07
kom.: +48 797 989 919
e-mail: [email protected]
www.toral.com.pl
Ciągniki, maszyny rolnicze i kompleksowy serwis. Części
zamienne, ogumienie, oleje i smary. Profesjonalne usługi
agrotechniczne i transportowe. Naprawy kombajnów, ciągników i maszyn rolniczych. Nawozy stałe i płynne - hurt - detal.
Środki ochrony roślin, atestacja opryskiwaczy.
Stoisko: E 592
P.P.H.U.Tomasz Olszak
Żerdź 110
24-103 Żyrzyn
kom.: +48 782 963 817, 661 813 935
e-mail: [email protected]
Firma nasza zajmuje się produkcją ładowaczy czołowych wraz
z wszelkim potrzebnym osprzętem:łyżki do materiałów sypkich,krokodyle,widły do palet,chwytaki do bel,pługi do śniegu.
W swojej ofercie posiadamy także agregaty ścierniskowe z
zabezpieczeniem sprężynowym i wałem rurowym.
Stoisko: A 18
Stoisko: C 211
TORNUM POLSKA Sp. z o.o.
ul. Sklęczkowska 16
99-300 Kutno
tel./fax: +48 24 254 65 20
e-mail: [email protected]
www.tornum.com
Dostarczamy kompleksowe rozwiązania nowych obiektów
susząco-magazynowych oraz rozbudowę już istniejących.
Oferujemy suszarnie porcjowe, suszarnie o ruchu ciągłym z
105
Spis wystawców
List of exhibitors
wydajnością do 100 t/h, suszarnie z odzyskiem ciepła HR do
30 %, silosy spedycyjne i magazynowe, podnośniki kubełkowe, redlery oraz urządzenia do wentylacji i schładzania ziarna.
We deliver complete solutions for drying, storage and conditioning of grain both for new plants and extensions of existing
facilities. We offer batch dryers, continuous flow dryers with
capacity up to 100 t/h, heat recovery dryer HR up to 30
%, square and round storage silos, conveying equipment,
aeration equipment and grain coolers.
Stoisko: C 407
Tout pour le grain
2, rue de Jonquilles
89260 PERCENEIGE
tel.: +33 38 688 98 00
fax: +33 38 688 90 20
e-mail: [email protected]
www.toutpourlegrain.fr
Francuska firma TOUT POUR LE GRAIN (TPLG) jest w
skali europejskiej specjalista w dziedzinie automatycznego
pobierania probek ziaren z obiektow statycznych iub w
ruchu. Legitymujac sie 35 latami doswiadczenia w branzy
zbozowej, TPLG jest reprezentowana w blisko trzydziestu
krajach i dysponuje ponad 3500 obiektami referencyjnymi.
Sonda "Czapla 3000", oferowana z opcjonalnym systemem
powrotu nadmiaru ziarna, utwierdza wiodaca pozycje TPLG
w Europie.
Total Polska Sp. z o.o.
Al. Jana Pawła II 80
00-175 Warszawa
Dział handlowy
tel.: +48 22 481 94 15
fax: +48 22 481 94 16
www.totalpolska.pl
Koncern Total jest jednym z wiodących światowych koncernów naftowych. Działa w ponad 150 krajach świata we
wszystkich sektorach przemysłu naftowego i gazu ziemnego,
zajmuje się również transportem i dystrybucją produktów
petrochemicznych. Od ponad 50 lat Total jest partnerem
rolników oferując szeroką gamę produktów specjalnie przeznaczoną dla maszyn rolniczych. Wykorzystując doświadczenia zdobyte w segmencie aut ciężarowych w 2007 roku
koncern TOTAL zaprezentował i wprowadził do sprzedaży
pierwszy przeznaczony dla maszyn rolniczych olej silnikowy
z gamy FUEL ECONOMY – TRACTAGRI HDX FE 15W30. W
wyniku dalszych badań i zmian wymagań stawianych przez
producentów maszyn rolniczych obecna gama FUEL ECONOMY dla rolnictwa rozszerzona została o nowe oleje silnikowe
i olej przekładniowo-hydrauliczny UTTO (gama DUO Eco):
TRACTAGRI HDX FE 15W30; TRACTAGRI HDZ FE 10W30;
DYNATRANS VX FE
The Total Group is one of the leading world petroleum groups.
It operates in over 150 countries around the world in all sectors of the petroleum and natural gas industry. It also offers
transport and distribution of petrochemical products. For
over 50 years, Total has assisted farmers, by offering them a
wide range of products specially designated for agricultural
machines. Following tests and changes in requirements of
agricultural machines producers, the current range of the
FUEL ECONOMY for agriculture has been extended with new
motor oils and transmission and hydraulic oil UTTO (DUO
Eco range): TRACTAGRI HDX FE 15W30;TRACTAGRI HDZ FE
10W30 and DYNATRANS VX FE.
Stoisko: E 111
The french company TOUT POUR LE GRAIN (TPLG) is a pan
European specialist in automatic cereals sampling from both
static and moving loads. Loocking back on 35 years of experience in that field, TPLG is being represented today in some
40 countries and has so far sold more than 3500 samplers.
Its sampler "Czapla 3000" makes TPLG the market leader in
automatic grain sampling in Europe.
Stoisko: E 298
TRAILER-TECH Sp. z o.o.
ul. Koszalińska 12
78-320 Połczyn Zdrój
tel.: +48 94 366 59 84
fax: +48 94 366 59 85
e-mail: [email protected]
www.agroliner.com
Produkujemy przyczepy wywrotki, przyczepy niskopodwoziowe, przyczepy z wyciągiem hakowym, pojazdy specjalne dla
przemysłu i rolnictwa, wykonujemy zabudowy samochodów,
remonty przyczep oraz prowadzimy sprzedaż części zamiennych. Jesteśmy filią i dystrybutorem wyrobów niemieckiej
firmy Peter Kroeger GmbH.
Stoisko: E 238
„TRAMP” J.J. Mikusz Sp. j.
ul. Sitki 73-75
41-810 Zabrze
tel.: +48 32 275 05 15
fax: +48 32 275 04 41
e-mail: [email protected]
www.tramp.pl
Stoisko: E 591
106
U
fax: +48 22 654 49 65
e-mail: [email protected]
www.tvr24.pl
Truck & Van/AGRO Expert
Redakcja miesięczników Truck & Van, TSL Biznes oraz
dodatków AGRO Expert, KOMUNAL Expert i CONSTRUCTION Expert
ul. Leopolda Staffa 31
01-884 Warszawa
tel.: +48 22 213 88 28
fax: +48 22 205 07 57
e-mail: [email protected]
www.truck-van.pl
Miesięcznik Truck & Van to magazyn, w którym piszemy
kompleksowo o wszystkim, co związane z transportem
samochodowym – zarówno dużym, jak i nieco mniejszym.
AGRO Expert (wcześniej Truck & Van AGRO) ukazuje się 4
razy w roku, prezentujemy w nim najciekawsze rozwiązania
produktowe, technologiczne, organizacyjne i transportowe
przeznaczone dla sektora rolniczego.
Truck & Van is a monthly magazine discussing in a complex
way all topics associated with car transport – both that „big”
one and that slightly „smaller”. AGRO Expert (formerly Truck
& Van AGRO) is published four times a year, we present here
the most interesting products solutions, technological, organizational and transport for the agricultural sector.
Stoisko: C 493
Tubes International Sp. z o.o.
ul. Bystra 15A,
61-366 Poznań
tel.: +48 61 653 02 22
fax: +48 61 653 02 20
e-mail: [email protected]
www.tubes-international.com
Tyczyńska Fabryka Urządzeń Wentylacyjnych
TYWENT Spółka z o.o.
Rok założenia: 1973r
ul. Orkana 1
36-020 Tyczyn
tel.: +48 17 221 97 12, 17 221 97 13
Dział handlowy +48 17 230 66 35, 17 230 66 30
e-mail: [email protected]
fax: +48 17 221 93 82
e-mail: [email protected]
www.tywent.com.pl
Tyczyńska Fabryka Urządzeń Wentylacyjnych "TYWENT"
Sp. z o.o. w Tyczynie jest polską firmą powstałą w 1973
roku. Firma specjalizuje się w produkcji wentylatorów i
urządzeń wentylacyjnych do rożnych procesów technologicznych. Stosowane technologie, właściwe do tego typu
produkcji dają gwarancję wysokiej jakości i niezawodności
wyrobów.
Stoisko: E 586
UAB „WESTERN FABRICATIONS”
Kapenai
LT89477 Mazeikiai
Lithuania
tel.: +37 044 328 548
fax: +37 044 328 546
e-mail: [email protected]
www.westerntrailers.eu
Stoisko: F 249
Tubes International Sp. z o.o. posiada 21 oddziałów w Polsce
oferując: przemysłowe węże gumowe, tworzywowe, teflonowe, stalowe, kompozytowe, silikonowe; obejmy, opaski;
zawory, złącza, szybkozłącza; kompensatory; elementy
pneumatyki; końcówki, szybkozłącza hydrauliczne; rury
hydrauliczne węże wysokociśnieniowe; prasy zaciskowe,
giętarki; pompy, rozdzielacze; bębny na węże, pistolety do
wody i powietrza, manometry.
Tubes International Sp. z o.o. have 21 department in most
industrial cities in Poland. Distributor of renowned producers
offer: rubber, PVC, PTFE, steel, composite industrial, hoses;
clamps, couplings, compensators; pneumatic accessories;
hydraulic couplings and fittings; high pressure hydraulic
hoses and machines for production hydraulic hoses; hose
reels, guns for water and air, gauges.
Stoisko: C 51
TVR Sp. z o.o.
Aleja 3-go Maja 2/29
00-391 Warszawa
tel.: +48 22 661 63 40
Stoisko: A 266
Unia Sp. z o.o.
Szosa Toruńska 32-38
86-300 Grudziądz
tel.: +48 56 451 05 00
fax: +48 56 451 05 01
e-mail: [email protected]
www.uniagroup.com
Stoisko: C 278
UNIMETAL Sp. z o.o.
ul. Kujańska 10
77-400 Złotów
tel./fax: +48 67 263 30 80
kom.+48 665 049 000
e-mail: [email protected]
www.unimetal.pl
107
Spis wystawców
List of exhibitors
Polski producent maszyn rolniczych. Przetrząsacz karuzelowy
Z-260 (dwuwirnikowy) wraz z przystawką wałującą PZ-1,
która ułatwia zbiór pokosu przeznaczonego na kiszonkę.
Zgniatacze do ziarna, H-745 – gniecie 4 podstawowe zboża
oraz kukurydzę, wydajność do 1800 kg/h, H-745/2 – gniecie
4 podstawowe zboża, wydajność do 1500 kg/h, H-200
gniecie 4 podstawowe zboża, a przede wszystkim owies,
wydajność do 200 kg/h.
Polish producer of agricultural machines. We offer: the hay
tedder Z-260 (2 rotors) with swathe former PZ-1 which facilitate harvest of the swathe on silage. Grain crushers: H-745
– crushing of corn, broad beans, peas and four basic grains,
capacity up to 1800 kg/h, H-745/2 – Cushing of four primary
types of grain, capacity up to 1500 kg/h, H-200 – Cushing
of the four primary grains and especially oat, capacity up to
200 kg/h.
UTECH Maszyny i Urządzenia Techniczne Norbert Koenig
Krapkowicka 10
45-715 Opole
tel.: +48 77 451 42 80
fax: +48 77 474 59 86
e-mail: [email protected]
www.utech.pl
UTECH Maszyny i Urządzenia Techniczne jest rodzinną firmą
oferującą kompleksową obsługę w zakresie sprzedaży, wynajmu oraz serwisu maszyn do prac rolnych, budowlanych i
leśnych. Oferta produktowa: rekultuwatory gruntów i mulczery
FAE; maszyny do budowy dróg polnych i leśnych FAE; koparki
i ładowarki TAKEUCHI; równiarki i zgarniarki ze sterowaniem
laserowym MONTEFIORI
Stoisko: D 419
UNIROL PARTS
Sp. z o.o. sp. k.
ul. Powstańców Wlkp. 11a
63-810 Borek Wielkopolski
tel.: +48 65 575 87 00
fax: +48 65 571 57 40
Stoisko: C 48
UTECH Maszyny i Urządzenia Techniczne is a family company
offering a comprehensive range of support in sale, rental and
service of agriculture, construction and forestry equipment.
Product portfolio: FAE land reclamation machines and
mulchers; FAE dirt and forestry road construction machines;
TAKEUCHI excavators and loaders; MONTEFIORI graders and
scrappers with laser control system.
Stoisko: A 17
Uniwersytet Przyrodniczy w Poznaniu
ul. Wojska Polskiego 28
60-637 Poznań
Katedra Genetyki i Hodowli Roślin
ul. Dojazd 11
60-632 Poznań
tel.: +48 61 848 77 16
e-mail: [email protected]
Kontakt:
Kierownik Katedry Genetyki i Hodowli Roślin
dr hab. Jerzy Nawracała
tel.: +48 61 848 77 20, 696 829 601
e-mail: [email protected]
Odmiana soi Augusta: odmiana doskonale dostosowaną do
warunków klimatycznych Polski. Nie jest modyfikowana genetycznie. Dojrzewa wiernie na początku września. Potencjał
plonowania przekracza 3,0 t /ha. Odmiany lnianki siewnej
ozimej LUNA i Maczuga oraz lnianki jarej OMEGA. Odmiany
wpisane do Księgi Ochrony Wyłącznego Prawa, potencjał
plonowania do 2 – 3 t/ha. Doskonałe do uprawy na glebach
lekkich.
V.ORLANDI POLSKA
ul. Sokołów 9
62-070 Dopiewo
kom.: +48 505 788 757, 518 955 114
e-mail: zamó[email protected]
www.orlandi.pl
V.ORLANDI-150 LAT ZAUFANIA, INNOWACYJNOSCI, DOŚWIADCZENIA! V.ORLANDI to uznany europejski producent
zaczepów dla ciągników, przyczep i maszyn rolniczych europejskich i światowych marek. V.Orlandi oferuje pełną gamę
zaczepów automatycznych i manualnych, ram mocujących
do ciągników oraz wszystkie typy systemów zaczepowych do
samochodów ciężarowych naczep i przyczep-zaczepów, siodeł żeliwnych i stalowych, podpór do naczep i obrotnic. Aby
sprostać wymaganiom klientów firma posiada magazyn w
Polsce obsługujący Europę Wschodnią dzięki któremu towar
dociera do klienta w ciągu maksymalnie 24 godzin.
Stoisko: B 365
USŁUGI OGÓLNOBUDOWLANE Robert Ciesielski
Kobylnicka 7
64-000 Ponin
tel.: +48 515 241 917
e-mail: [email protected]
www.oknawielkopolska.pl
Stoisko: D 546
108
Stoisko: D 80
V.V.M TechTrade Polska Spółka z o.o.
Zakrzewo ul. Przemysłowa 20
62-070 Dopiewo
tel./fax: +48 61 875 42 33
kom: +48 517 615 332
e-mail: [email protected]
www.vvm-techtrade.de
V
Szeroki asortyment: podajniki koralikowe, podajniki spiralne,
ruszta plastikowe, panele do wygrodzeń. Produkcja i sprzedaż.
Width range of products: chain conveying systems, spiral
conveying systems, plastic slats, PVC panels. Production
and sale.
Stoisko: E 436
Vilofoss Polska Sp. z o.o.
ul. dr. Alberta Schmidta 1, Żołędowo
86-031 Osielsko
tel.: +48 52 381 31 68
www.vilofoss.pl
Vilofoss Polska jest producentem mieszanek
pełnoporcjowych i uzupełniających dla trzody chlewnej,
bydła, drobiu oraz innych zwierząt gospodarskich. W
swojej ofercie posiada również produkty specjalne m.in.
X-Zelit, Stalosan F i Active NS. Spółka należy do Vitfoss
A/S, największego producenta premiksów w Europie oraz
jest członkiem międzynarodowej grupy Vilofoss, będącej
częścią koncernu DLG.
Väderstad
ul. Jakubowska 35
62–045 Pniewy
tel.: +48 61 291 22 15
fax: +48 61 291 21 99
e-mail: [email protected]
www.vaderstad.com
Producent maszyn do uprawy gleby i siewu. Ceniony przez
rolników w całej Europie za najwyższą jakość oraz uniwersalność oferowanego sprzętu. Produkty Väderstad, sprawdzają
się w każdych warunkach glebowych oraz we wszystkich
technologiach uprawy. Firma gwarantuje swoim klientom
doradztwo, serwis posprzedażowy oraz pełną i szybką
dostępność części zamiennych.
Polish agent of Swedish soil tillage and drilling machines manufacturer. By farmers in Europe valued for the highest quality
and versatility of offered equipment. Väderstad products turn
out to be useful in every soil conditions and every tillage technology. The company guarantees to its clients the complete
and fast service along with full access to spare parts.
Stoisko: F 309
VB Leasing Polska SA
ul. Strzegomska 42b
53-611 Wrocław
Infolinia: 0 801 199 199,
tel.: +48 71 334 48 80
fax: +48 71 334 49 01
VB LEASING od ponad 10 lat wspiera rozwój polskich przedsiębiorstw rolnych. Oferujemy leasing operacyjny i finansowy
maszyn i urządzeń rolniczych oraz pożyczkę dla rolników. Finansujemy projekty inwestycyjne z wykorzystaniem środków
unijnych. Ponadto oferujemy leasing urządzeń medycznych,
maszyn produkcyjnych i budowlanych, środków transportu
ciężkiego oraz samochodów osobowych.
For over 10 years VB LEASING has been supporting development of Polish agricultural enterprises. We offer operational
and financial leasing of agricultural machines and appliances,
and loans for farmers. We finance investment projects using
EU funds. Moreover, we offer leasing of medical devices, production and construction machines, cars and heavy vehicles.
Vilofoss Polska is a producer of premixes, protein concentrates and complete feed for pigs, cattle, poultry and other
livestock. The offer also includes supplementary products
such as X-Zelit, Stalosan F and Active NS. The company is
owned by Vitfoss A/S, the biggest producer of premixes in
Europa. It is a member of the international group – Vilofoss,
being a part of DLG Group.
Stoisko: E 300
Virago Produkt S.C.
J.Łuczak; A.Łuczak
ul. Poznańska 75
62-040 Puszczykowo
tel./fax: +48 61 813 39 23
e-mail: [email protected],
[email protected]
www.mjwnarzedzia.pl
Virago Produkt grupa produkcyjno-handlowa to doskonałej
jakości narzędzia polskiej produkcji Produkt ze znakiem
MJW to profesjonalizm i perfekcja. Produkujemy rozmaite
narzędzia min: klucze nasadowe krótkie i przedłużane;
klucze płaskie i różne ich warianty i osprzęt do nich. Nasza
oferta jest dla tych którzy chcą pracować niezawodnymi
narzędziami
Virago Group has accumulated abundant experience on the
producing, trading and marketing of highest quality hand
tools made in Poland. Product with “MJW” trade mark means
excellence and professionalism. Our company is specialized
in production hardware tools such as short and long sockets
with special accessories etc.
Stoisko: F 156
Stoisko: D 225
109
Spis wystawców
List of exhibitors
fax: 0044 284 3772 050
e-mail: [email protected]_Watson.co.uk
www.Walter_Watson.co.uk
VOGEL & NOOT Polska Sławomir Langner
ul. Opolska 39
49-100 Niemodlin
tel.: +48 77 460 61 29
fax: +48 77 460 66 75
e-mail: [email protected]
www.vogelnoot.pl
Stoisko: C 398
Stoisko: D 223
Vogelsang Sp. z o.o.
ul. Stefana Grota Roweckiego 168
52-214 Wrocław
tel.: +48 71 798 95 80
fax: +48 71 798 95 82
e-mail [email protected]
www.vogelsang.pl
Pompy rotacyjne do gnojowicy i ścieków (stacjonarne i
na WOM). Rozdrabniacze RotaCut i X-Ripper. Systemy
dozowania i rozlewu gnojowicy (rozdzielacze, rampy z
wleczonymi wężami). PowerFill – wspomaganie załadunku
beczek próżniowych. X-Till – agregat do nawożenia gnojowicą
przy rzędowej bez orkowej uprawie kukurydzy. Dozowniki
mieszająco – pompujące QuickMix i EnergyJet do biogazowi.
Agregaty pompująco – rozdrabniające BioCut.
Stoisko: C 200
Weidemann Polska
ul. Polna 124/126
87-100 Toruń
tel.: +48 56 639 05 97
fax: +48 56 639 05 98
www.weidemann.pl
Doradztwo i sprzedaż:
Polska północno-wschodnia +48 509 686 790
Polska północno-zachodnia +48 509 686 791
Polska południowo-wschodnia +48 509 686 792
Polska południowo-zachodnia +48 509 686 793
W swojej ofercie posiadamy ładowarki podwórzowe HOFTRAC®, ładowarki kompaktowe oraz ładowarki teleskopowe.
Każdą z maszyn możecie Państwo wyposażyć w opcje
dodatkowe dedykowane do specjalistycznych zastosowań.
Posiadamy duży wybór narzędzi roboczych. Zapraszamy do
zapoznania się z naszą ofertą.
In our offer you can find yard loaders HOFTRAC®, wheel
loaders, tele wheel loaders and telehandlers. To each of that
machines you can order a options dedicated for special use.
To our loaders we offer you many of working tools. We invite
you to check our offer.
Stoisko: D 288
P.P.H.U. VOLANT s.c.
D. Grabowski, U. Grabowski
Nowe Opole, ul. Piękna 55
08-103 Siedlce
tel./fax: +48 25 632 25 58
e-mail: [email protected]
www.volant.com.pl
Stoisko: B 30
Vreten AB
Vreten
54194 Skovde
tel.: 0046500 45 70 00
fax: 0046500 46 65 29
e-mail: [email protected]
www.vreten.se
Stoisko: C 504
WALD-GOLD Sp. z o.o.
ul. Marii Konopnickiej 20
17-120 Brańsk
tel.: 85 737 62 62
e-mail: [email protected]
www.waldgold.pl
Stoisko: D 553
Walter Watson
Greenfield Works
Ballylough Road
Castlewellan, Co.Down
Northern Ireland, BT31 9JQ
tel.: 0044 284 3778 711
110
WEREMCZUK FMR
ul. Bełżycka 73
24-220 Niedrzwica Duża
tel./fax: +48 81 517 15 61, 81 517 15 66, 81 517 15 60
e-mail: [email protected],
www.weremczukagro.pl
WEREMCZUK FMR jest producentem maszyn rolniczych
do warzywnictwa i sadownictwa. Oferujemy kombajny do
zbioru porzeczek, malin i wiśni, wycinacze pędów porzeczek,
agregaty otrząsająco-czyszczące do wiśni i śliw, kosiarki i
rozdrabniacze sadownicze oraz siewniki punktowe, maszyny i
agregaty do formowania redlin, sadzarki do rozsady, ogławiarki do marchwi, kombajny do zbioru marchwi.
WEREMCZUK FMR is the manufacturer of machines for fruit
and vegetable growing. We offer currant, cherry, raspberry
harvesters, pruning mashines, cherry and plum shaking machines with cleaning unit, orchard platforms, rotary mower-slashers, single-seed sowing machines, machines for ridge
forming, vegetable transplanters, carrot toppers, vegetable
harvesters for carrot.
Stoisko: C 526
W
Wesem D.M.T. Hajduk Spółka Jawna
ul. Grottgera 4
32-020 Wieliczka
tel.: +48 12 278 12 95
WESEM – polska firma z ponad trzydziestoletnią tradycją,
wytwarza oświetlenie samochodowe, lampy do ciągników
i pojazdów wolnobieżnych. Posiada wykwalifikowaną kadrę
specjalistów, nowoczesny park maszynowy oraz własny dział
badawczo-rozwojowy. Firma z powodzeniem sprzedaje swoje
produkty zarówno w kraju jak i za granicą głównie do krajów
Europy.
WESEM – Polish producer of automotive lighting, operating on
the market for more than three decades. Produces headlights
and additional lights for passenger cars, lorries and work
lamps for tractors, construction and agricultural machines.
Ours is a team of dedicated specialists, R&D department and
laboratory. The company successfully sells its products both
at home and abroad, mainly to Europe.
Stoisko: F 155
Gazeta Sołecka
Al. Niepodległości 151/6
02-555 Warszawa
tel.: +48 22 404 66 44
e-mail: [email protected]
www.gazetasolecka.pl
Dział reklamy:
tel.: +48 797 901 123
tel/fax +48 22 404 88 55
e-mail: [email protected]
Dział prenumeraty:
tel.: +48 797 901 118
tel/fax +48 63 243-84-61
e-mail: [email protected]
Ogólnopolski, wysokonakładowy miesięcznik, ponad 20 lat na
rynku. Co miesiąc dociera do 40 tys. osób w kraju: sołtysów,
radnych, wójtów, burmistrzów oraz gmin, administracji regionalnej i urzędów centralnych a także do innych mieszkańców
małych miast i wsi. Prenumeruje nas prawie 11 tysięcy
rolników z całego kraju.
Nationwide, high-volume monthly, more than 20 years on the
market. Every month, reaches to 40 thousand people in the
country: village mayors, councilors, mayors and municipal,
regional and central offices as well as other residents of small
towns and villages. Subscribe to our 11,000 farmers from all
over the country.
Wiadomości Rolnicze Polska Sp z o.o.
ul. Konstytucji 3 maja 30
72-100 Goleniów
tel./fax: +48 91 418 27 22
Stoisko: C 379
WRP Biznes to dwutygodnik biznesowy skupiający się głównie na zagadnieniach mikro i makroekonomicznych w prowadzeniu działalności rolnej, w oparciu o prawo UE oraz krajowe,
notowania rynkowe, prognozowanie oraz rachunkowość dla
gospodarstw rolnych. Zachęcamy do składania zamówień
na prenumeratę poprzez naszą stronę internetową www.wrp.pl
Stoisko: C 376
WIELKOPOLSKIE CENTRUM HODOWLI I ROZRODU
ZWIERZĄT w POZNANIU
z/s w Tulcach Sp. z o.o.
ul. Poznańska 13
63-004 Tulce
tel.: +48 61 872 73 30, 873 85 00
fax: +48 61 872 73 54
e-mail: [email protected]
www.wchirz.pl
WCHiRZ oferuje nasienie buhajów krajowych i zagranicznych,
których potomstwo znacząco poprawi opłacalność produkcji
mleka, pozwoli na zdobywanie nagród na wystawach hodowlanych. Wysoka jakość genetyczna rozpłodników gwarantuje
szybki i trwały postęp hodowlany!
Stoisko: hala 14
„BYDŁO”
Redakcja Ogólnopolskiego Czasopisma
Specjalistycznego
ul. Mickiewicza 33
60-837 Poznań
tel.: +48 61 843 44 25
fax: +48 61 843 44 26
e-mail: [email protected]
www.bydlo.net.pl
„TRZODA CHLEWNA”
Redakcja Ogólnopolskiego Czasopisma
Specjalistycznego
ul. Mickiewicza 33
60-837 Poznań
tel.: +48 61 843 44 25
fax: +48 61 843 44 26
e-mail: [email protected]
www.trzoda-chlewna.com.pl
Wielkopolskie Wydawnictwo Rolnicze Sp. z o.o. – wydawca
Ogólnopolskich Czasopism Specjalistycznych „TRZODA
CHLEWNA” i „BYDŁO” – miesięczników dla hodowców i producentów świń oraz bydła, zootechników i lekarzy weterynarii
zawierających informacje na temat: nowoczesnych technologii produkcji i ekonomiki chowu, najnowszych osiągnięć z
zakresu hodowli i żywienia, weterynarii i profilaktyki chorób,
111
Spis wystawców
List of exhibitors
działalności firm paszowych, farmaceutycznych i handlowych,
wystaw, targów, seminariów poświęconych hodowli i produkcji zwierzęcej, polityki rolnej państwa.
Wielkopolskie Wydawnictwo Rolnicze Sp. z o.o. – Agricultural
Publishing House Ltd. – publisher of monthly editions for pig and
cattle breeders, producers, zootechnicians, dairy sector and vets
in Poland. It contains problems of animal husbandry: modern
technology in animal breeding and production, economics of
meat and milk production, medical treatment and prevention,
current information about exhibitions, fairs and conferences.
Stoisko: C 497
WIELTON S.A.
ul. Baranowskiego 10a
98-300 Wieluń
tel.: +48 43 843 45 10 wew. 502, 504
fax: +48 43 845 34 10
e-mail: [email protected]
www.wielton.com.pl
WIELTON S.A. to największy, polski producent przyczep i
naczep, należący do głównych producentów tej branży w
Europie. Oferuje blisko 60 typów pojazdów transportowych:
naczepy skrzyniowe, plandekowe, samowyładowcze, do przewozu maszyn, podkontenerowe, chłodnie, furgony, zestawy
wielkogabarytowe, zabudowy wywrotkowe oraz przyczepy
rolnicze sygnowane marką WIELTON AGRO.
WIELTON S.A. is the largest Polish producer of trailers and
semitrailers, belonging to the main producers in Europe in that
industry. It offers about 60 types of transport vehicles: semitrailers: box, tarpaulin, tilt, for machine and container transport,
refrigerated trailers, wagons, large-size assemblies, dumper
constructions and agricultural trailers of WIELTON AGRO brand.
Stoisko: B 190
Południowa Oficyna Wydawnicza
ul. Wolności 1A
63-200 Jarocin
tel.: +48 62 747 15 31
fax: +48 62 747 37 60
e-mail: [email protected]
www.wiescirolnicze.pl
WIMAR
ul. Kolejowa 16
23-200 Kraśnik
tel./fax: +48-81-825-11-63
tel.: +48-81-826-41-94, 826-41-93, 826-41-92, 826-41-91
e-mail: [email protected], [email protected]
www.wimar.net
Worki raszlowe, worki polipropylenowe, worki ażurowe, worki
jutowe, worki Big-Bag, siatki opakowaniowe, rękawice robocze, plandeki rolnicze, gumki recepturki, siatka do paletowania, agrowłókniny, agrotkaniny, worki siatkowe kontenerowe,
stabilizowane UV 80x120cm i 105x130cm, tyczki bambusowe, skrzyniopalety, skrzynki plastikowe, łubianki plastikowe,
opakowania celulozowe, sznurek sizalowy.
Raschel bags with drawstring and on rolls, woven polypropylene bags, pp leno mesh bags, jute bags, Big-Bags, packing
nets-knitted sleeve, working gloves, tarpaulins, rubber bands,
pallet net, stretch foil, nonwovens, shading nets, container net
bags for firewood UV stabilized 80x120cm and 105x130cm,
bamboo poles, plastic containers, plastic crates, paper
packages, sisal twine.
Stoisko: C 505
Wolf System
ul. Budowlana 17
41-100 Siemianowice Śląskie
tel.: +48 32 605 37 00
fax: +48 32 605 37 15
e-mail: [email protected]
www.wolfsystem.pl
Stoisko: D537
„Wieści Rolnicze” ukazują się w całej Wielkopolsce oraz w
trzech powiatach Dolnego Śląska. Nakład magazynu wynosi
od 42.000 do 45.000 egzemplarzy. Publikujemy artykuły
poruszające problemy ważne dla rolników. Przekazujemy
informacje o nowych uregulowaniach prawnych, dopłatach
z Unii, przepisach emerytalno-rentowych, a także porady
agronomów, specjalistów ODR i firm obsługujących wieś.
Prezentujemy wyspecjalizowane gospodarstwa, przetwórnie i
produkty służące rolnikom.: Fachowe treści chcemy przekazywać prostym, przystępnym językiem.
Stoisko: C 528
112
WILHELM STOLL MASCHINENFABRIK GmbH
Bahnhofstrasse 21
D 38268 Lengede
Niemcy
tel.: +49 53 44 20 0
fax: +49 53 44 20 182
e-mail: [email protected]
www.stoll-jf.de
Stoisko: B 187
WOL-MET
Roman Wolny
Zielona Wieś 78
63-900 Rawicz
Firma nasza zajmuje się produkcją ładowaczy czołowych,
powstała w 2005r. Dlatego posiada duże doświadczenie w
produkcji ładowaczy co za tym idzie awaryjność naszych
produktów nie przekracza 1%. Każdy typ ładowacza jest dokładnie przetestowany, posiada instrukcję montażu deklarację
zgodności CE, 12 miesięczną gwarancję.
Stoisko: B 22
Z
67 LAT TRADYCJI. Od 1946 r. MORPAK jest wiodącym
polskim producentem wysokiej klasy uszczelek: silnikowych,
skrzyń biegów, układów wydechowych, pokryw zaworów oraz
mis olejowych. Nasze wyroby spełniają najwyższe wymagania
klientów oraz norm jakościowych.
P.P.U.H. Woprol Jerzy Worek
Wiercany 12
39-124 Iwierzyce
tel./fax: +48 17 745 42 20
kom.: +48 604 373 464
e-mail: [email protected]
www.woprol.com.pl
Stoisko: C 208
67 Years of Tradition. Since 1946 MORPAK has been the leading Polish producer of high quality: engine gaskets, gearbox
gaskets, exhaust sytem gaskets, valve cover gaskets and oil
pan gaskets. Our products meet the highest demands of our
clients and quality standards.
Stoisko: D 99
Wyrób Galanterii z Metalu „Walterscheid” - Service
ul. Wiosenna 67
62-081 Baranowo
tel./fax: 61 814 22 36
e-mail: [email protected]
www.walterscheid.poznan.pl
Stoisko: A 263
Yara Poland Sp. z o.o.
Al. 3 Maja 1
70-214 Szczecin
tel.: +48 91 433 00 35
fax: 48 91 433 04 34
e-mail: [email protected]
www.yara.pl
Wytwórnia Filtrów „PZL-Sędziszów” S.A.
ul. Fabryczna 4
39-120 Sędziszów Młp.
tel.: +48 17 745 02 00
fax: +48 17 745 03 33
e-mail: [email protected]
www.wf-filter.pl
Wytwórnia Filtrów „PZL-Sędziszów” S.A. to lider rynku wyrobów filtracyjnych. Od ponad 70 lat produkuje filtry paliwa, powietrza i olejów do wszelkiego rodzaju silników oraz urządzeń
roboczych. Prowadzi też zaawansowane badania w dziedzinie
rozwoju technologii urządzeń filtracyjnych. W sektorze
rolniczym filtry z Sędziszowa są od lat wykorzystywane przez
największych producentów ciągników i maszyn rolniczych.
Oferta produktowa, pod marką WF Filter, jest systematycznie
rozszerzana i unowocześniana.
PZL-Sedziszow Joint-Stock Company is leader in filtration
products, manufacturing air, fuel and oil filters for all types of
motor engines and working devices for over 70 years. It also
conducts advanced research in the field of filtration equipment
technology development. In the agricultural sector, its filters
have been used for years by the largest manufacturers of
tractors and agricultural machinery. Its offer, under the name
of WF Filter, is regularly extended and modernized to include
new products.
Yara Poland oferuje najwyższej jakości nawozy dla rolnictwa
i ogrodnictwa: nawozy azotowe (CAN, Sulfan), wieloskładnikowe pogłówne lub przedsiewne YaraMila, najwyższej jakości
nawozy fosofrowe, specjalistyczne nawozy mikroelementowe
typu YaraVita dla upraw rolnych,posypowe i rozpuszczalne
nawozy dla upraw ogordniczych typu YaraMila Complex, YaraLiva. Yara Poland offers high quality fertilizers for agriculture:
N fertilizers (CAN, Sulfan), NPK fertilizers (yaraMila), YaraVita
– range of micronutrients for foliar application in arable crops,
solid and soluble fertilizers for speciality crops.
Stoisko: A 313
Z.B.P.S KEMPF Sp. z o.o.
ul. Zamkowa 9
58-530 Kowary
tel.: +48 75 649 90 00
fax: +48 75 649 97 50
e-mail: [email protected]
www.kempf.pl
Stoisko: F 247
Stoisko: D 548
Wytwórnia Uszczelek „MORPAK” Paweł Jaworski
ul. Wołodyjowskiego 16
83-050 Łapino
tel./fax: +48 58 682 72 10
e-mail: [email protected]
www.morpak.pl
ZHU ARGO Paweł Kaliński
Witusza 24
99-412 Kiernozia
kom.: +48 600 829 514
www.zhu-argo.pl
ZHU ARGO zajmuje się produkcją i sprzedażą opryskiwaczy
sadowniczych oraz opryskiwaczy do truskawek. Wykonujemy
opryskiwacze na indywidualne zamówienie klienta.
Stoisko: C 67
113
Spis wystawców
List of exhibitors
Zakład Mechaniczny PROGRESS Leszek Sawicki
Nowa Wieś Książęca 4a
63-640 Bralin
tel.: +48 62 781 96 10
e-mail: [email protected]
www.zmprogress.pl
Zakład Mechaniczny Progress został założony w 1995 roku
przez Leszka Sawickiego obecnego prezesa firmy. Pierwszymi
produktami były zamki, krzywki i zawiasy. Aktualnie głównym
produktem firmy ZM PROGRESS są tunele foliowe produkowane wspólnie z angielską firmą Haygrove oraz od 3 lat hit na
Polskim rynku HALE NA BALE, posiadające szerokie zastosowanie przy ochronie płodów rolnych, maszyn rolniczych. Firma
jako jedyna w Polsce oferuje również Kurniki mobilne.
Stoisko: D 550
ZAKŁAD MECHANIKI MASZYN
I URZĄDZEŃ ROLNICZYCH
Sławomir Biardzki
ul. Północna 34
08-106 Zbuczyn
tel./fax: +48 25 641 65 40
kom.: +48 608 058 156, 608 058 441
e-mail: [email protected]
www.biardzki.eu
AGROMASZ - producent ładowaczy czołowych o udźwigu
800÷1650 kg i wysokości podnoszenia 3÷4 m do wszystkich typów ciągników rolniczych, osprzętu umożliwiającego
załadunek, rozładunek oraz transport obornika, materiałów
sypkich i okopowych, kiszonek, bel zwijanych słomy, palet.
AGROMASZ - manufacturer of front loaders with lifting
capacity 800÷1650 kg and lifting height 3 ÷ 4 m to all types
of agricultural tractors and equipment for loading, unloading
and transport of manure, bulk materials and root vegetables,
silage, straw bale, pallets.
Stoisko: F 261
Stoisko: C 59
ZMN
ZAK£AD MECHANIZMÓW NAPÊDOWYCH S.C.
Zakład Mechanizmów Napędowych S.C.
Gabriela Szydłowska, Roman Tański
ul. Katowicka 1
78-300 Świdwin
tel.: +48 94 365 20 91
fax: +48 94 365 26 41
e-mail: [email protected]
Nasza Firma na rynku producentów części zamiennych istnieje
od 1954 roku. Głównymi produktami naszej firmy są: koła zębate stożkowe, łańcuchowe i walcowe do różnego typu maszyn
rolniczych, ciągników i samochodów; części do ciągników
C-330, C-360, C-385; części do kosiarek rotacyjnych do trawy.
Specjalizujemy się dodatkowo w hartowaniu, nawęglaniu,
hartowaniu indukcyjnym. Wysoka jakość i zadowolenie klienta
należą do podstawowych zasad polityki naszej firmy.
Our Company has been operating in a market of spare parts
producer since 1954. Our main products include:bevel gears,
chain wheels and cylindrical gears for agricultural machines,
tractors, and cars of various types; parts for tractors: C-330,
C-360, C-385; parts for rotary grass mowers. Additionally,
we specialise in tempering, carbonisation, and inductive
tempering. High quality and customer satisfaction are basic
principles in our company policy.
Stoisko: F 140
114
Zakład Metalowy AGROMASZ
ul. Lubelska 42B
11-700 Mrągowo
tel./fax: +48 89 741 21 92
e-mail: [email protected]
www.agromasz.com.pl
Zakład Naprawczy Mechanizacji Rolnictwa
ul. Konińska 18
62-045 Pniewy
tel.: +48 61 291 18 38
fax: +48 61 291 00 56
e-mail: [email protected]
www.zakladnaprawczy.pl
Specjalizacja: remonty kapitale silników ciągników Ursus,
Perkins, MF itd, samochodów ciężarowych i dostawczych
oraz koparek, dźwigów itd., remonty kapitalne ciągników
oraz wózków widłowych, koparek itd., naprawy pomp wtryskowych rzędowych, rozdzielaczowych i elektronicznych,
regeneracja pomp hydraulicznych, rozdzielaczy, siłowników,
wspomagań kierownicy, serwomechanizmów, regeneracja turbosprężarek silników, sprężarek samochodowych,
stacjonarnych, naprawy ciągnikowych skrzyni biegów,
przodów, regeneracja podnośników ciągnikowych–plecaków
i ich pomp.
Stoisko: D 103
Zakład Produkcyjno - Handlowy
Stanisław Krzaczek
Klikawa, ul. Leśna 5
24-100 Puławy
tel.: +48 81 880 64 44
fax: +48 81 880 60 18
e-mail: [email protected]
www.krzaczek.eu
Od 1987 roku firma ZPH Stanisław Krzaczek zajmuje się
produkcją kotłów grzewczych. Wykorzystując długoletnie doświadczenie i czerpiąc z najnowszych osiągnięć techniki, stale
podnosimy jakość oferowanych wyrobów i staramy się za-
Z
spokoić wymagania swoich klientów, zarówno pod względem
funkcjonalności oraz estetyki. Nasze produkty znalazły uznanie
zarówno w Polsce jak i w Europie, wielokrotnie nagradzane za
innowacje, ekologię i jakość.
fax: +48 13 442 90 69
e-mail: [email protected]
www.zmprzysieki.eu
The Company ZPH Stanisław Krzaczek has been manufacturing boilers since 1987. Using our extensive experience and
the latest technologies we continuously improve the quality
of provided products and strive at satisfying requirements
of our customers, in terms of functionality and appearance.
Our products won recognition both in Poland and in Europe,
winning numerous prizes for innovativeness, environmental
aspects and quality.
Zakłady Sprzętu Mechanicznego URSUS Sp. z o.o.
ul. Słowackiego 3a
86-200 Chełmno
tel.: +48 56 677 01 40
fax: +48 56 677 01 44
e-mail: [email protected]
www.ursus.pl
Stoisko: D 106
Stoisko: F 466
Stoisko: D 569
Zakład Ślusarski Greń Sp.j. Bolesław i Grażyna Greń
ul. K. Miarki 1B
43-200 Pszczyna
tel.: +48 32 326 34 70
fax: +48 441 81 21
[email protected]
www.ecogren.pl
Stoisko: E 453
Hodowla Ziemniaka Zamarte Sp. z o.o.
-Grupa IHAR
Zamarte, ul. Parkowa 1
89-430 Kamień Krajeński
tel.: +48 52 388 15 76
e-mail: [email protected]
www.zamarte.com
Hodowla Ziemniaka Zamarte Sp. z o.o.- Grupa IHAR jest
od lat liderem na rynku odmian ziemniaka w Polsce, przede
wszystkim w grupie odmian bardzo wczesnych i wczesnych –
jadalnych, skrobiowych, na susze ziemniaczane i chipsy
Zakłady Chemiczne „Siarkopol” Tarnobrzeg Sp. z o.o.
ul. Chemiczna 3
39-400 Tarnobrzeg,
Sekretariat:
tel.: +48 15 856 58 01
fax: +48 15 822 97 97
Biuro Obsługi Klienta:
tel.: +48 15 856 58 58
fax: +48 15 855 55 67
e-mail: [email protected]
www.zchsiarkopol.pl
Oferta: nawozy granulowane: Superfosfat prosty, Unifoska,
Potafoska, Superfoska, Tarnogran, Wap Mag, Wigor S, Siarczan Magnezu granulowany, Dolomit, Ogród 2001, Bontar;
siarka mielona, mielona-olejowana, granulowana
Offered products: Mineral fertilizers: agricultural, Horticultural;
Sulphur: granulated, powder, oiled.
Stoisko: A 314
Zakłady Górniczo-Metalowe „Zębiec” S.A.
Zębiec
27-200 Starachowice
tel.: +48 41 276 74 00
fax: +48 41 276 75 00
e-mail: [email protected]
www.zebiec.pl
Stoisko: F 147
Zakłady Metalowe w Przysiekach Sp. z o.o.
Przysieki 421
38-207 Przysieki
tel.: +48 13 442 90 20
Hodowla Ziemniaka Zamarte Sp. z o.o.- Grupa IHAR is a
leader on the potato varieties market In Poland, mainly in early
group of varieties. Destinations: direct consumption, starch,
dry products, chips.
Stoisko: hala 6
Zakład Produkcyjno – Usługowy “ZAMET” Ryszard i
Marcin Zabielscy Spółka Jawna
09-472 Słupno
ul. Akacjowa 8
tel.: 24 386 27 51
fax. 24 261 29 07
www.zamet.org.pl
[email protected]
Zakład Produkcyjno – Usługowy „ZAMET” działa nie przerwanie od 1978 roku. Na początku rozpoczęliśmy produkcję
rozrzutników do obornika. Kolejną maszyną która powstała
w naszej firmie, była przyczepa samozbierąjąca o symbolu
fabrycznym T183/1. W w kolejnych latach do oferowanego
przez nas asortymentu wprowadziliśmy ścinacze zielonek
T635 w wersjach do zbioru trawy i ziół typu: mięta, szpinak,
pietruszka itp. Ostatnią nowością jest obsypnik do pryzm o
symbolu P427, cieszący się dużym zadowoleniem wśród
użytkowników. Do naszym produktów należy również zaliczyć,
włókę łąkową, równarkę pryzm. Nasze produkty wyróżniają
się na tle konkurencji powtarzalnością, niezawodnością,
wysoką jakością podzespołów oraz sprawdzoną myślą
techniczną.
115
Spis wystawców
List of exhibitors
Production and Service Company ZAMET has been operating
on the market since 1978 ceaselessly. At first we produced
manure spreaders following with the loader and silage wagon
T183/1. In the following years we also introduced green forage mowers T635 in a version adapted to collecting grass or
herb plants like mint, spinach, parsley to mention just a few.
The latest novelty is a prism lister P427 received enthusiastically among its users. Our products also include a grassland
drag and a prism leveller. Compared to competing companies,
our products are exceptional in terms of reliability, good quality of components and carefully checked technical concept.
Stoisko: B 33
Zasław TSS Sp. z o.o. Sp. K.
ul. Krakowska 140
34-120 Andrychów
tel.: +48 508 01 01 01
fax: +48 33 875 16 66
www.zaslaw.pl
Stoisko: C 283
Zetor Polska Sp. z o.o.
Wroclawska 48
62-800 Kalisz
tel.: +48 62 501 44 00
fax: +48 62 501 44 99
e-mail: [email protected]
www.zetor.pl
Stoisko: F 153
Zuidberg Frontline Systems BV
Buitenveld 5
8307 DE ENS
tel.: +31 (0)527 253550
fax: +31 (0)527 253037
[email protected]
www.zuidberg.pl
Zuidberg Frontline Systems – czołowy producent układów
przedniego zawieszania TUZ oraz WOM do wszystkich popularnych marek ciągników: Case, New Holland, John Deere,
Fendt, Landini, Valtra, McCormick i innych. W ofercie także
systemy gąsienicowe do ciągników i kombajnów. Wyłączny
importer na Polskę: Polboto-Agri Sp. z o.o.
Stoisko: D 79
Wyłączny dystrybutor ciągników marki Zetor oraz oryginalnych części zamiennych w Polsce. Dystrybutor kosiarek
rotacyjnych, bębnowych, dyskowych, ładowaczy czołowych, pługów, przetrząsaczy, zgrabiarek, ciągników do prac
komunalnych oraz urządzeń do prac leśnych montowanych
na ciągniki.
An exclusive distributor of Zetor products, namely, tractors
and original spare parts in Poland. Distributor of rotary
mowers, drum, disc, front loader, plows, rakes, tractors used
for municipal works and equipment for forestry mounted on
tractors.
Stoisko: E 297
ZUPTOR Spółka z o.o.
ul. Ogrodowa 6
63-800 Gostyń,
tel.: +48 65 572 50 90
tel.: +48 65 572 94 81
fax: +48 65 575 17 65
e-mail: [email protected]
Internet www.zuptor.pl
Wieloletni producent wysokiej jakości: mieszalników pasz pionowych i poziomych; rozdrabniaczy bijakowych, zasypowych
i do słomy; linii do przygotowania paszy w układzie pełnej
automatyzacji; natłuszczarek; przenośników taśmowych,
ślimakowych, spiralnych; silosów zbożowych i paszowych;
podnośników kubełkowych; wyposażenia do magazynów
silosowo-nasienno-zbożowych. W ofercie również maszyny
wstępnego i dokładnego czyszczenia; zaprawiarki; systemy
ważące, wagi inwentarzowe.
Manufacturer of mixers; breakers; fully automatic lines for
feed preparation; oiling machines, belt conveyors, auger
conveyors; grain and feed silos; bucket elevators; equipment
for seed and grain silo stores; pre-cleaning and post-cleaning
machines; dressing machines; weighing systems, livestock
weighers
Ogólnopolski tygodnik „ Zielony Sztandar”
Wydawnictwo Ludowe Sp. z. o.o
ul. Kopernika 36/40
00-924 Warszawa
tel.: +48 22 620 74 49, 22 620 75 56
Stoisko: D 412
„Zielony Sztandar” jest tygodnikiem społeczno- politycznym,
który nieprzerwanie ukazuje się 75 lat (od 1931 roku).
Stoisko: hala 3
116
Złotecki Sp. z o.o.
Żelechlin 2
88-111 Rojewo
tel.: +48 22 519 02 78
fax: +48 22 378 16 79
e-mail: [email protected]
www.zlotecki.pl
Skontaktuj się z nami:
Merlo Polska Sp. z o.o.
ul. Warszawska 109
05-092 Łomianki
biuro: tel. 22 751 20 22
[email protected]
www.merlo.com
ŚĆ
WO
ZLI ACJI
R
MO
EST
NIK
REJ CIĄG !
Y
O
JAK LNICZ
RO
Z A P R A S Z A M Y
h o d o w c ó w
k a c z e k i g ę s i
GWARANTUJEMY
długoterminowe
u m o w y
kontraktacyjne
„AMI” Spółka z ograniczoną odpowiedzialnością S.K.A.
63-510 Mikstat, ul. Stara Droga 1, sekretariat: tel./fax 62/ 731 08 00
dz. kontraktacji: tel. 62/731 05 80, e-mail: [email protected]
PRODUCENT
www.joskin.com
OD 1968 SŁUŻYMY ROLNICTWU!
45
lat
JOSKIN
1968/2013
Europejski lider produkcji wozów asenizacyjnych
www.joskin.com
tel. 67 216 82 99
Najszersza na rynku gama przyczep i rozrzutników
obornika
Pozwól nam poskładać Twoją inwestycję.
• Elastyczna oferta - finansowanie od 1 roku do 10 lat
• Plan spłat rat dostosowany do charakteru produkcji
• Wpłata własna już od 0%
Dział Weidemann Polska
Zeskanuj kod i
doświadcz więcej.
www.weidemann.pl
Finansowanie zostanie udzielone
w oparciu o wyliczoną zdolność
kredytobiorcy. Niniejsza informacja
nie stanowi oferty w rozumieniu
przepisów KC.
WM_Finance_PL_128x180_vertical.indd 1
ul.Polna 124/126, 87-100 Torun
tel. 56 639 05 97, fax 56 639 05 98
Polska
Polska
Polska
Polska
Płn
Płn
Płd
Płd
- Wsch
– Zach
– Wsch
– Zach
509
509
509
509
686
686
686
686
790
791
792
793
03.09.2013 08:34:56
ENErgia dla goSpodarStWa
Wieloletnie doświadczenie
we współpracy z polskimi
rolnikami
Sprzedaż najwyższej jakości
produktów: propanu i mieszaniny propan-butan
Kompleksowa realizacja
instalacji na gaz płynny
zasilających suszarnie zbóż
i fermy drobiu
Największa polska firma
na rynku gazu płynnego
Zapraszamy na nasze stoisko!
Sektor C, numer 385
www.orlengaz.pl
[email protected]
Centrum Obsługi Klienta
801 100 100
Części do maszyn uprawowych
PIERWSZOMONTAŻOWA
JAKOŚĆ
Index 351016
ISSN 1230-1825
Dwutygodnik
Nr 11 (506)
Rok XXII
1 czerwca 2013 r.
Cena 4 z³ (w tym 5% VAT)
Biznes
Lepsze rolnictwo, lepszy biznes, lepsze życie
Tworząc gazetę WRP Biznes, skupiamy się na zagadnieniach
mikro i makroekonomicznych w prowadzeniu działalności rolnej,
w opraciu o prawo UE i krajowe, notowania rynkowe, prognozowanie
i rachunkowość dla gospodarstw rolnych.
Oferta specjalna:
Do 1 lipca 2013 r. możesz wykupić naszą prenumeratę z 50% zniżką.
Więcej informacji na naszej stronie internetowej: www.wrp.pl
3 miesiące - 15 PLN
*Ceny zawierają VAT i rabat
6 miesięcy - 29 PLN
12 miesięcy - 54 PLN
ZESKANUJ kod
dobierz olej
www.orlenoil.pl
Infolinia: 0 801 102 103
autoryzowany dystrubutor olejów smarnych:
Platinum oil wielkoPolskie centrum dystrybucji sP. z o.o.
ul. Budowlanych 3-5, Baranowo, 62-081 Przeźmierowo
[email protected], www.platinumoil.eu
www.najbar.com.pl
MASZYNY
OPAKOWANIA
SERWIS
FH Najbar
12 411 59 59
ZAPRASZAMY NA BEZPŁATNE SZKOLENIA
WIĘCEJ INFORMACJI NA:
ROLNICTWO EKOLOGICZNE
HODOWLA PSZCZÓŁ
SZKÓŁKARSTWO
HODOWLA KRÓLIKÓW
AGROTURYSTYKA
HODOWLA DROBIU
ZARZĄDZANIE GOSPODARSTWEM
HODOWLA OWIEC
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
0101 Ciągniki/Tractors
AGROMA Przesiębiorstwo Handlowe S.A. w Poznaniu . . . . . . . . . . . . . . . . . . . . 11 . . . . . A 171
AGROCHŁOPECKI S.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . . A 19
ZAKŁAD METALOWY AGROMASZ GRUSZCZEWSKI JANUSZ . . . . . . . . . . . . . . . . 114 . . . . . F 261
AGROTIMH Tomasz Iwaszkiewicz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 . . . . . D 215
AGCO Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 . . . . . D 285
AGROMIX PUP Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 . . . . . A 263
BARTESKO PRZEDSIĘBIORSTWO WIELOBRANŻOWE. Bartłomiej Skowroński . . . . . . . . 23 . . . . . . C 69
CENTRUM TECHNIKI ROLNICZEJ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 31 . . . . . C 507
CASE IH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . D 284
CMKS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . C 210
ZETOR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . E 297
PROGRASS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87 . . . . . . . A 3
STOMIL SANOK - DYSTRYBUCJA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . 101 . . . . . D 102
SAME DEUTZ - FAHR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . 94 . . . . . C 275
STAL IMPEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 . . . . . D 542
PERKOZ PRZEDSIĘBIORSTWO HANDLOWO-USŁUGOWE Sp. z o.o. . . . . . . . . . . . . . 80 . . . . . B 184
PRZEDSIĘBIORSTWO ROMANOWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . 88 . . . . . D 286
PREMIUM TRADE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . . B 38
KORBANEK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65 . . . . . B 269
KINGSPAN ENVIRONMENTAL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 62 . . . . . . D 87
KAGRO Krzysztof Pankowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . B 188
VRETEN AB . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . C 504
JANSSEN POLAND Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59 . . . . . E 229
HYDRAMET PPHU Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . A 169
INTERHANDLER Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 58 . . . . . C 277
HEIN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52 . . . . . . B 24
MERLO POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . F 311
HYDRO-MASZ SĘCERSKI SPÓŁKA JAWNA PRZEDSIĘBIORSTWO PRODUKCYJNO-HANDLOWE55 . . . . C 205
FARMER Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 42 . . . . . C 204
FARMTRAC TRACTORS EUROPE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 42 . . . . . F 301
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
AGROMEHANIKA d.d. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11 . . . . . C 595
S.C. TOMIT AGRI MACCHINE SRL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . E 605
CLAAS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . F 302
0102 Ciągniki - osprzęt i części/Tractors - accessories and spare parts
AGROMA Przesiębiorstwo Handlowe S.A. w Poznaniu . . . . . . . . . . . . . . . . . . . . 11 . . . . . A 171
AGE-POWER Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 . . . . . E 117
AGROCHŁOPECKI S.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . . A 19
AGRO-JAN S.c. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10 . . . . . . C 44
AGROGRUPA BOŻENA DRABEK SPÓŁKA KOMANDYTOWO-AKCYJNA . . . . . . . . . . . . 10 . . . . . F 154
Branżowy spis wystawców
nr str.
stoisko
AGCO Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 . . . . . D 285
BARTESKO PRZEDSIĘBIORSTWO WIELOBRANŻOWE. Bartłomiej Skowroński . . . . . . . . 23 . . . . . . C 69
BRAT-MET JANIK SPÓŁKA JAWNA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28 . . . . . . D 98
CASE IH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . D 284
CMKS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . C 210
ZAKŁAD MECHANIZMÓW NAPĘDOWYCH S.C. Gabryjela Szydłowska Roman Tański . . . . 114 . . . . . F 140
ZETOR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . E 297
V. ORLANDI POLAND Sp. z o.o. Sp.k. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . . D 80
TOOLMEX TRUCK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . C 375
PROGRASS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87 . . . . . . . A 3
POLBOTO-AGRI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83 . . . . . . D 79
SIMENA SPÓŁDZIELNIA Z.P.CH. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97 . . . . . F 135
SAUTER GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 94 . . . . . F 150
LSN LUBLIN . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . hala 34
ROLNICTWO PRECYZYJNE ANDRZEJ PRZEPERSKI . . . . . . . . . . . . . . . . . . . . . 92 . . . . . . D 96
PERKOZ PRZEDSIĘBIORSTWO HANDLOWO-USŁUGOWE Sp. z o.o. . . . . . . . . . . . . . 80 . . . . . B 184
PRZEDSIĘBIORSTWO ROMANOWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . 88 . . . . . D 286
PARTNER SYSTEMS SPÓŁKA Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 . . . . . . D 86
OTTO TH. MENKE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . . C 45
WYTWÓRNIA USZCZELEK MORPAK Paweł Jaworski . . . . . . . . . . . . . . . . . . . . 113 . . . . . . D 99
KNOTT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 63 . . . . . . C 73
KORBANEK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65 . . . . . B 269
KINGSPAN ENVIRONMENTAL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 62 . . . . . . D 87
KAGRO Krzysztof Pankowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . B 188
VRETEN AB . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . C 504
J.A. GĄSKA Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59 . . . . . F 132
HEIN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52 . . . . . . B 24
FELIKS NAGLAK Przedsiębiorstwo Produkcyjno Usługowo Handlowe . . . . . . . . . . . . 43 . . . . . F 260
EUROAGRICOLA ANDRES . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 40 . . . . hala 29
ENA LTD Sp z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 . . . . . C 597
DANBUD DANIEL PIASECKI PRODUKCJA I HANDEL MASZYNY ROLNICZE . . . . . . . . . . 34 . . . . . E 573
INTER-TECH P.P.H.U. Piotr Jankowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . 58 . . . . . D 599
WYRÓB GALANTERII Z METALU WALTERSCHEID-SERVICE . . . . . . . . . . . . . . . . . 113 . . . . . A 263
AGRO-EKO P.W. Grzegorz Pilch . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . A 263
CLAAS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . F 302
0103 Nośniki narzędzi/Tool carriers
CENTRUM TECHNIKI ROLNICZEJ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 31 . . . . . C 507
CASE IH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . D 284
CRYSTAL TRAKTOR Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . D 287
WEIDEMANN POLSKA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . D 288
SAUTER GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 94 . . . . . F 150
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
METALINVEST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . MICHALAK PRZEDSIĘBIORSTWO PRODUKCYJNO-HANDLOWO-USŁUGOWE . . . . . . . . KOMATSU POLAND Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MERLO POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . INTER-TECH P.P.H.U. Piotr Jankowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . ATMP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74 . . . . . C 206
75 . . . . . . A 10
64 . . . . . D 218
73 . . . . . F 311
58 . . . . . D 599
20 . . . . . . A 12
0104 Ciągniki specjalne/Special tractors
BARTESKO PRZEDSIĘBIORSTWO WIELOBRANŻOWE. Bartłomiej Skowroński . . . . . . . . 23 . . . . . . C 69
CENTRUM TECHNIKI ROLNICZEJ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 31 . . . . . C 507
CASE IH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . D 284
CMKS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . C 210
ZETOR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . E 297
SAME DEUTZ - FAHR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . 94 . . . . . C 275
PRZEDSIĘBIORSTWO ROMANOWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . 88 . . . . . D 286
PREMIUM TRADE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . . B 38
HORTMASZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . E 231
0105 Ciągniki wąskie/Narrow-track tractors
CENTRUM TECHNIKI ROLNICZEJ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . CASE IH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
CMKS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . POLBOTO-AGRI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . SAME DEUTZ - FAHR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . PRZEDSIĘBIORSTWO ROMANOWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . KORBANEK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
HORTMASZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
31 . . . . . C 507
30 . . . . . D 284
32 . . . . . C 210
83 . . . . . . D 79
94 . . . . . C 275
88 . . . . . D 286
65 . . . . . B 269
55 . . . . . E 231
0106 Mini-ładowarki/Farmyard and animal housing loaders
BROKER SERWIS MASZYNY BUDOWLANE PHU JAN SURMA . . . . . . . . . . . . . . . . 28 . . . . . . A 14
BARTESKO PRZEDSIĘBIORSTWO WIELOBRANŻOWE. Bartłomiej Skowroński . . . . . . . . 23 . . . . . . C 69
WEIDEMANN POLSKA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . D 288
TOOLMEX TRUCK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . C 375
PICHON S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 . . . . . B 183
MADAR RENATA SCHMIDT . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . F 152
KAGRO Krzysztof Pankowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . B 188
SERAFIN P.U.H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . D 294
INTERHANDLER Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 58 . . . . . C 277
MERLO POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . F 311
DAMIAN Firma Handlowo-Usługowa . . . . . . . . . . . . . . . . . . . . . . . . . . . . 34 . . . . . D 543
Branżowy spis wystawców
nr str.
stoisko
0107 Ładowarki kołowe i przegubowe/Wheel loaders
BROKER SERWIS MASZYNY BUDOWLANE PHU JAN SURMA . . . . . . . . . . . . . . . . 28 . . . . . . A 14
BARTESKO PRZEDSIĘBIORSTWO WIELOBRANŻOWE. Bartłomiej Skowroński . . . . . . . . 23 . . . . . . C 69
WEIDEMANN POLSKA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . D 288
STOMIL SANOK - DYSTRYBUCJA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . 101 . . . . . D 102
PICHON S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 . . . . . B 183
PRZEDSIĘBIORSTWO ROMANOWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . 88 . . . . . D 286
MADAR RENATA SCHMIDT . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . F 152
KOMATSU POLAND Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64 . . . . . D 218
KAGRO Krzysztof Pankowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . B 188
KRAMER-WERKE GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65 . . . . . D 214
INTERHANDLER Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 58 . . . . . C 277
MERLO POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . F 311
EWPA-MASZYNY BUDOWLANE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . 41 . . . . . D 219
DAMIAN Firma Handlowo-Usługowa . . . . . . . . . . . . . . . . . . . . . . . . . . . . 34 . . . . . D 543
0108 Ładowarki teleskopowe/Telehandlers
BARTESKO PRZEDSIĘBIORSTWO WIELOBRANŻOWE. Bartłomiej Skowroński . . . . . . . . 23 . . . . . . C 69
WEIDEMANN POLSKA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . D 288
POLBOTO-AGRI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83 . . . . . . D 79
SAME DEUTZ - FAHR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . 94 . . . . . C 275
PRZEDSIĘBIORSTWO ROMANOWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . 88 . . . . . D 286
KORBANEK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65 . . . . . B 269
KAGRO Krzysztof Pankowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . B 188
KRAMER-WERKE GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65 . . . . . D 214
INTERHANDLER Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 58 . . . . . C 277
MERLO POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . F 311
FARESIN INDUSTRIES S.P.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41 . . . . . C 207
EWPA-MASZYNY BUDOWLANE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . 41 . . . . . D 219
EMPLEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 . . . . . . D 88
DITTA SERIA Edmund Pietrzak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . D 216
DIECI S.r.l. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . F 304
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
CLAAS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . F 302
0109 Ładowacze czołowe, zawieszane i przyczepiane/Front, rear and tail loaders
ZAKŁAD METALOWY AGROMASZ GRUSZCZEWSKI JANUSZ . . . . . . . . . . . . . . . . 114 . . . . . F 261
BONDIOLI & PAVESI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . . . C 61
CASE IH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . D 284
CRYSTAL TRAKTOR Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . D 287
ZETOR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . E 297
WILHELM STOLL MASCHINENFABRIK GmbH . . . . . . . . . . . . . . . . . . . . . . . . 112 . . . . . B 187
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
WOL-MET ROMAN WOLNY . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 112 . . . . . . B 22
TOMASZ OLSZAK P.P.H.U. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . . A 18
PROGRASS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87 . . . . . . . A 3
POLBOTO-AGRI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83 . . . . . . D 79
SIPMA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97 . . . . . C 212
SAUTER GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 94 . . . . . F 150
PRZEDSIĘBIORSTWO ROMANOWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . 88 . . . . . D 286
METALINVEST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74 . . . . . C 206
MICHALAK PRZEDSIĘBIORSTWO PRODUKCYJNO-HANDLOWO-USŁUGOWE . . . . . . . . 75 . . . . . . A 10
KORBANEK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65 . . . . . B 269
KAGRO Krzysztof Pankowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . B 188
HYDROMETAL TOMASZ KOWALEWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . 56 . . . . . F 243
HYDRAMET PPHU Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . A 169
GREGOIRE-BESSON POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . E 295
FOKUS P.P.H.U. RADOSŁAW FIBNER WALDEMAR STASZAK . . . . . . . . . . . . . . . . . 45 . . . . . D 570
EMPLEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 . . . . . . D 88
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
DANBUD DANIEL PIASECKI PRODUKCJA I HANDEL MASZYNY ROLNICZE . . . . . . . . . . 34 . . . . . E 573
INTER-TECH P.P.H.U. Piotr Jankowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . 58 . . . . . D 599
CLAAS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . F 302
0201 Przyczepy i pojazdy transportowe/Trailers and transport vehicles
AGROMA Przesiębiorstwo Handlowe S.A. w Poznaniu . . . . . . . . . . . . . . . . . . . . 11 . . . . . A 171
AGRARSAM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 . . . . . E 234
AGROMIX PUP Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 . . . . . A 263
BLYSS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . . C 74
BERUTEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 . . . . . E 228
BARTESKO PRZEDSIĘBIORSTWO WIELOBRANŻOWE. Bartłomiej Skowroński . . . . . . . . 23 . . . . . . C 69
BINOTTO POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 . . . . . F 138
BAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . D 422
CAMARA POLONIA JESUS MANUEL CAMARA PEREZ . . . . . . . . . . . . . . . . . . . . 30 . . . . . E 230
WIELTON S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 112 . . . . . B 190
ZAMET ZAKŁAD PRODUKCYJNO-USŁUGOWY Ryszard I Marcin Zabielscy Sp.j. . . . . . . 115 . . . . . . B 33
UAB WESTERN FABRICATIONS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . F 249
PTM TRADE-CENTRUM RUCHOMYCH PODŁÓG . . . . . . . . . . . . . . . . . . . . . . . 89 . . . . . E 233
POLBOTO-AGRI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83 . . . . . . D 79
SCHUITEMAKER MACHINES B.V. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . E 131
SOCIETE PROMODIS (SPÓŁKA AKCYJNA SPÓŁDZIELNIA) ODDZIAŁ W POLSCE . . . . . . . 98 . . . . . B 180
STILL POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101 . . . . . C 534
ROLMETAL Przedsiębiorstwo Produkcyjno Handlowe . . . . . . . . . . . . . . . . . . . . 92 . . . . . A 172
POL-STRAUTMANN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 85 . . . . . A 175
PRZEDSIĘBIORSTWO ROMANOWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . 88 . . . . . D 286
Branżowy spis wystawców
nr str.
stoisko
PARTNER SYSTEMS SPÓŁKA Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 . . . . . . D 86
PORSCHE INTER AUTO POLSKA Sp. z o.o.- SALON VOLKSWAGEN . . . . . . . . . . . . . 86 . . . . . C 523
METALINVEST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74 . . . . . C 206
NT INDUSTRY SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 78 . . . . . F 257
LUDWIG BERGMANN GmbH Maschinenfabrik . . . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . F 258
KORBANEK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65 . . . . . B 269
Z.B.P.S. KEMPF Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 113 . . . . . F 247
KAGRO Krzysztof Pankowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . B 188
JOSKIN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 289
INTER CARS S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57 . . . . . . C 54
FLIEGL AGRARTECHNIK GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . D 220
ENDRESS-POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 . . . . . F 163
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
ANNABURGER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . E 581
0202 Przyczepy wywrotki/Tippers
AGRARSAM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 . . . . . E 234
BV BECO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . E 130
BLYSS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . . C 74
BINOTTO POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 . . . . . F 138
BAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . D 422
WIELTON S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 112 . . . . . B 190
PETER KRÖGER GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 . . . . . E 238
PTM TRADE-CENTRUM RUCHOMYCH PODŁÓG . . . . . . . . . . . . . . . . . . . . . . . 89 . . . . . E 233
SIPMA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97 . . . . . C 212
STOMIL SANOK - DYSTRYBUCJA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . 101 . . . . . D 102
ROLTECH-CONOW Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . F 248
POL-STRAUTMANN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 85 . . . . . A 175
EKO-INVEST SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 38 . . . . . E 237
NT INDUSTRY SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 78 . . . . . F 257
MOSKIT PRZEDSIĘBIORSTWO PRODUKCYJNO USŁUGOWO HANDLOWE . . . . . . . . . . 76 . . . . . C 193
KORBANEK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65 . . . . . B 269
Z.B.P.S. KEMPF Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 113 . . . . . F 247
KELLFRI SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 62 . . . . . E 235
JOSKIN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 289
JANSSEN POLAND Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59 . . . . . E 229
INTER CARS S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57 . . . . . . C 54
FLIEGL AGRARTECHNIK GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . D 220
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
S.C. TOMIT AGRI MACCHINE SRL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . E 605
ANNABURGER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . E 581
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
0203 Przyczepy objętościowe/Silage trailers
AGRARSAM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 . . . . . E 234
BV BECO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . E 130
BLYSS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . . C 74
BAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . D 422
CAMARA POLONIA JESUS MANUEL CAMARA PEREZ . . . . . . . . . . . . . . . . . . . . 30 . . . . . E 230
WIELTON S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 112 . . . . . B 190
UNIA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . C 278
PETER KRÖGER GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 . . . . . E 238
PTM TRADE-CENTRUM RUCHOMYCH PODŁÓG . . . . . . . . . . . . . . . . . . . . . . . 89 . . . . . E 233
SIPMA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97 . . . . . C 212
SCHUITEMAKER MACHINES B.V. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . E 131
ROLTECH-CONOW Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . F 248
POL-STRAUTMANN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 85 . . . . . A 175
EKO-INVEST SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 38 . . . . . E 237
NT INDUSTRY SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 78 . . . . . F 257
LUDWIG BERGMANN GmbH Maschinenfabrik . . . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . F 258
KAGRO Krzysztof Pankowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . B 188
JOSKIN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 289
INTER CARS S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57 . . . . . . C 54
HEIN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52 . . . . . . B 24
FLIEGL AGRARTECHNIK GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . D 220
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
DAF AGRO - ANDO TECH Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . E 600
ANNABURGER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . E 581
0204 Przyczepy skorupowe/Monoshell tipping trailers
BV BECO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . E 130
BLYSS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . . C 74
BEDNAR FMT s.r.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . F 310
CAMARA POLONIA JESUS MANUEL CAMARA PEREZ . . . . . . . . . . . . . . . . . . . . 30 . . . . . E 230
WIELTON S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 112 . . . . . B 190
PETER KRÖGER GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 . . . . . E 238
ROLTECH-CONOW Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . F 248
EKO-INVEST SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 38 . . . . . E 237
NT INDUSTRY SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 78 . . . . . F 257
KAGRO Krzysztof Pankowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . B 188
JOSKIN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 289
INTER CARS S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57 . . . . . . C 54
FLIEGL AGRARTECHNIK GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . D 220
GREGOIRE-BESSON POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . E 295
Branżowy spis wystawców
nr str.
stoisko
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
ANNABURGER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . E 581
0205 Przyczepy, wyposażenie i części/Trailers - accessories and spare parts
ATW S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21 . . . . . E 226
AGROGRUPA BOŻENA DRABEK SPÓŁKA KOMANDYTOWO-AKCYJNA . . . . . . . . . . . . 10 . . . . . F 154
BLYSS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . . C 74
BONDIOLI & PAVESI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . . . C 61
V. ORLANDI POLAND Sp. z o.o. Sp.k. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . . D 80
PETER KRÖGER GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 . . . . . E 238
PTM TRADE-CENTRUM RUCHOMYCH PODŁÓG . . . . . . . . . . . . . . . . . . . . . . . 89 . . . . . E 233
STEELPRESS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 . . . . . E 121
LSN LUBLIN . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . hala 34
ROLTECH-CONOW Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . F 248
OTTO TH. MENKE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . . C 45
KNOTT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 63 . . . . . . C 73
JOSKIN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 289
INTER CARS S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57 . . . . . . C 54
FLIEGL AGRARTECHNIK GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . D 220
ANNABURGER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . E 581
0206 Przyczepy do transportu zwierząt/Livestock trailers
BLYSS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . . C 74
JOSKIN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 289
FIRMA NOWAK Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 43 . . . . . C 536
0207 Przyczepy przeładunkowe/Transshipping trailers
AGRARSAM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 . . . . . E 234
BLYSS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . . C 74
BERUTEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . CAMARA POLONIA JESUS MANUEL CAMARA PEREZ . . . . . . . . . . . . . . . . . . . .
SCHUITEMAKER MACHINES B.V. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ROLTECH-CONOW Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 . . . . . E 228
22 . . . . . D 422
30 . . . . . E 230
95 . . . . . E 131
93 . . . . . F 248
HORSCH MASCHINEN GMBH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . F 307
RICHIGER (LANDTECHNIK GUT RENZOW GMBH) . . . . . . . . . . . . . . . . . . . . . . 90 . . . . . . B 32
LUDWIG BERGMANN GmbH Maschinenfabrik . . . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . F 258
KOBZARENKO Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 63 . . . . . F 250
FLIEGL AGRARTECHNIK GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . D 220
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
ANNABURGER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . E 581
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
0208 Kontenery, zbiorniki/Containers, tanks
UNIMETAL SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . D 419
SITONO WYTWÓRNIA SIT KRZYSZTOF NOWAKOWSKI . . . . . . . . . . . . . . . . . . . 97 . . . . . C 386
PARTNER SYSTEMS SPÓŁKA Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 . . . . . . D 86
METALINVEST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74 . . . . . C 206
NT INDUSTRY SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 78 . . . . . F 257
MICHALAK PRZEDSIĘBIORSTWO PRODUKCYJNO-HANDLOWO-USŁUGOWE . . . . . . . . 75 . . . . . . A 10
MEPROZET KOŚCIAN S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . D 293
FLIEGL AGRARTECHNIK GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . D 220
POMOT PUP SP. Z O.O. (Chojna) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . C 276
ANNABURGER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . E 581
0209 Pojazdy specjalistyczne/Special vehicles
BUSCHHOFF TH. GmbH & Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . C 404
BARTESKO PRZEDSIĘBIORSTWO WIELOBRANŻOWE. Bartłomiej Skowroński . . . . . . . . 23 . . . . . . C 69
WIELTON S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 112 . . . . . B 190
UAB WESTERN FABRICATIONS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . F 249
WEIDEMANN POLSKA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . D 288
PETER KRÖGER GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 . . . . . E 238
TOOLMEX TRUCK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . C 375
PTM TRADE-CENTRUM RUCHOMYCH PODŁÓG . . . . . . . . . . . . . . . . . . . . . . . 89 . . . . . E 233
PRONAR PHU DARIUSZ KAWKA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87 . . . . . D 104
PARTNER SYSTEMS SPÓŁKA Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 . . . . . . D 86
PORSCHE INTER AUTO POLSKA Sp. z o.o.- SALON VOLKSWAGEN . . . . . . . . . . . . . 86 . . . . . C 523
METALINVEST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74 . . . . . C 206
NT INDUSTRY SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 78 . . . . . F 257
ENA LTD Sp z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 . . . . . C 597
BEMO MOTORS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . E 297
0210 Wózki widłowe/Fork lifts
BARTESKO PRZEDSIĘBIORSTWO WIELOBRANŻOWE. Bartłomiej Skowroński . . . . . . . . 23 . . . . . . C 69
TOOLMEX TRUCK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . C 375
STILL POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101 . . . . . C 534
LOGIS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . C 517
SERAFIN P.U.H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . D 294
GEO Di BOERI GIOVANNA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47 . . . . . . . A 2
ENA LTD Sp z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 . . . . . C 597
0301 Maszyny do uprawy roli/Soil working
AGRO-MIX PRODUCENT MASZYN ROLNICZYCH SOBAŃSKA ZOFIA . . . . . . . . . . . . . 12 . . . . . . A 13
AGROMA Przesiębiorstwo Handlowe S.A. w Poznaniu . . . . . . . . . . . . . . . . . . . . 11 . . . . . A 171
Branżowy spis wystawców
nr str.
stoisko
APV POLSKA DANUTA MŁOCEK-BIEŻUŃSKA . . . . . . . . . . . . . . . . . . . . . . . . AGROMIX PUP Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . AGRISEM INTERNATIONAL S.A.S. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BAGRAMET SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BIURO DORADCZO-HANDLOWE JACEK KRÓL . . . . . . . . . . . . . . . . . . . . . . . .
18 . . . . . . B 37
12 . . . . . A 263
8 . . . . . F 306
22 . . . . . B 185
26 . . . . . E 236
BEDNAR FMT s.r.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . F 310
CELLI S.p.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . . B 28
CENTRUM TECHNIKI ROLNICZEJ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 31 . . . . . C 507
WEREMCZUK FMR Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . C 526
ZETOR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . E 297
UNIA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . C 278
UNIROL PARTS SP. Z O.O. SP.K. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . . C 48
VOGEL&NOOT Polska Sławomir Langner . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . D 223
VÄDERSTAD Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 109 . . . . . F 309
ROLMAKO P.H.U.T.P. HENRYK KOWALSKI . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . A 176
SALIDA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . C 402
PROGRASS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87 . . . . . . . A 3
POLBOTO-AGRI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83 . . . . . . D 79
SOLAN T.CZECH, Ł.CZECH Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98 . . . . . C 521
STALTECH Grzegorz Dobrzański . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 . . . . . B 181
SOCIETE PROMODIS (SPÓŁKA AKCYJNA SPÓŁDZIELNIA) ODDZIAŁ W POLSCE . . . . . . . 98 . . . . . B 180
PERKOZ PRZEDSIĘBIORSTWO HANDLOWO-USŁUGOWE Sp. z o.o. . . . . . . . . . . . . . 80 . . . . . B 184
PRZEDSIĘBIORSTWO ROMANOWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . 88 . . . . . D 286
PREMIUM TRADE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . . B 38
OPALL-AGRI s.r.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 . . . . . . B 25
MICHALAK PRZEDSIĘBIORSTWO PRODUKCYJNO-HANDLOWO-USŁUGOWE . . . . . . . . 75 . . . . . . A 10
MOSKIT PRZEDSIĘBIORSTWO PRODUKCYJNO USŁUGOWO HANDLOWE . . . . . . . . . . 76 . . . . . C 193
MANDAM SP. Z O.O. PRZEDSIĘBIORSTWO PRODUKCYJNO HANDLOWE . . . . . . . . . . 70 . . . . . D 224
LEMKEN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . F 308
KORBANEK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65 . . . . . B 269
KÖCKERLING GmbH & Co. KG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64 . . . . . B 189
KAGRO Krzysztof Pankowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . B 188
GRANO-SYSTEM ILONA KULETA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . . B 21
HENRYK Firma Henryk Batyra . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52 . . . . . F 259
GREGOIRE-BESSON POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . E 295
EXPOM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41 . . . . . C 276
DAL-BO A/S . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . A 173
DURO-FRANCE / AGRI-CONSULT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 37 . . . . . D 213
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
S.C. TOMIT AGRI MACCHINE SRL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . E 605
ATMP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20 . . . . . . A 12
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
ALOIS PÖTTINGER Maschinenfabrik GmbH . . . . . . . . . . . . . . . . . . . . . . . . . 16 . . . . . C 281
AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . F 305
0302 Głębosze/Subsoilers
AGRONOMIK POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . C 192
AGROMAX S.C. Stanisław Osek, Tomasz Osek . . . . . . . . . . . . . . . . . . . . . . . 11 . . . . . C 197
AGRISEM INTERNATIONAL S.A.S. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 . . . . . F 306
BAGRAMET SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . B 185
BIURO DORADCZO-HANDLOWE JACEK KRÓL . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . E 236
BEDNAR FMT s.r.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . F 310
CELLI S.p.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . . B 28
VOGEL&NOOT Polska Sławomir Langner . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . D 223
ROLMAKO P.H.U.T.P. HENRYK KOWALSKI . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . A 176
SALIDA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . C 402
STALTECH Grzegorz Dobrzański . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 . . . . . B 181
SKOTAREK Produkcja Maszyn Rolniczych i Części Jerzy Skotarek . . . . . . . . . . . . . . 97 . . . . . C 198
MANDAM SP. Z O.O. PRZEDSIĘBIORSTWO PRODUKCYJNO HANDLOWE . . . . . . . . . . 70 . . . . . D 224
LEMKEN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . F 308
KORBANEK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65 . . . . . B 269
GRANO-SYSTEM ILONA KULETA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . . B 21
GREGOIRE-BESSON POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . E 295
EXPOM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41 . . . . . C 276
DAL-BO A/S . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . A 173
DURO-FRANCE / AGRI-CONSULT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 37 . . . . . D 213
0303 Pługi/Ploughs
AGRO-MIX PRODUCENT MASZYN ROLNICZYCH SOBAŃSKA ZOFIA . . . . . . . . . . . . . 12 . . . . . . A 13
AGRO-MASZ Paweł Nowak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11 . . . . . A 168
AGRONOMIK POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . C 192
BIURO DORADCZO-HANDLOWE JACEK KRÓL . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . E 236
ZETOR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . E 297
UNIA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . C 278
UNIROL PARTS SP. Z O.O. SP.K. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . . C 48
VOGEL&NOOT Polska Sławomir Langner . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . D 223
PROGRASS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87 . . . . . . . A 3
STOMIL SANOK - DYSTRYBUCJA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . 101 . . . . . D 102
STALTECH Grzegorz Dobrzański . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 . . . . . B 181
PREMIUM TRADE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . . B 38
OPALL-AGRI s.r.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 . . . . . . B 25
LEMKEN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . F 308
KORBANEK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65 . . . . . B 269
Branżowy spis wystawców
nr str.
stoisko
GEO Di BOERI GIOVANNA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47 . . . . . . . A 2
GREGOIRE-BESSON POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . E 295
DURO-FRANCE / AGRI-CONSULT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 37 . . . . . D 213
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
ALOIS PÖTTINGER Maschinenfabrik GmbH . . . . . . . . . . . . . . . . . . . . . . . . . 16 . . . . . C 281
0304 Grubery/Stubble cultivators
AGRO-MIX PRODUCENT MASZYN ROLNICZYCH SOBAŃSKA ZOFIA . . . . . . . . . . . . . 12 . . . . . . A 13
AGRO-MASZ Paweł Nowak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11 . . . . . A 168
AGRONOMIK POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . C 192
BIURO DORADCZO-HANDLOWE JACEK KRÓL . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . E 236
BEDNAR FMT s.r.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . F 310
VOGEL&NOOT Polska Sławomir Langner . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . D 223
ROLMAKO P.H.U.T.P. HENRYK KOWALSKI . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . A 176
TOMASZ OLSZAK P.P.H.U. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . . A 18
STALTECH Grzegorz Dobrzański . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 . . . . . B 181
SKOTAREK Produkcja Maszyn Rolniczych i Części Jerzy Skotarek . . . . . . . . . . . . . . 97 . . . . . C 198
REMPRODEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 90 . . . . . F 253
MANDAM SP. Z O.O. PRZEDSIĘBIORSTWO PRODUKCYJNO HANDLOWE . . . . . . . . . . 70 . . . . . D 224
ARMASZ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 . . . . . . A 15
LEMKEN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . F 308
KORBANEK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65 . . . . . B 269
KÖCKERLING GmbH & Co. KG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64 . . . . . B 189
GRANO-SYSTEM ILONA KULETA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . . B 21
GREGOIRE-BESSON POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . E 295
EXPOM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41 . . . . . C 276
DAL-BO A/S . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . A 173
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
ALOIS PÖTTINGER Maschinenfabrik GmbH . . . . . . . . . . . . . . . . . . . . . . . . . 16 . . . . . C 281
AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . F 305
0305 Brony talerzowe/Disc harrows
AGRO-MIX PRODUCENT MASZYN ROLNICZYCH SOBAŃSKA ZOFIA . . . . . . . . . . . . . 12 . . . . . . A 13
AGRO-MASZ Paweł Nowak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11 . . . . . A 168
AGRONOMIK POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . C 192
BURY MASZYNY ROLNICZE - WOJCIECH BURY . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . F 301
BIURO DORADCZO-HANDLOWE JACEK KRÓL . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . E 236
BEDNAR FMT s.r.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . F 310
UNIROL PARTS SP. Z O.O. SP.K. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . . C 48
VOGEL&NOOT Polska Sławomir Langner . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . D 223
VÄDERSTAD Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 109 . . . . . F 309
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
ROLMAKO P.H.U.T.P. HENRYK KOWALSKI . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . A 176
SALIDA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . C 402
STALTECH Grzegorz Dobrzański . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 . . . . . B 181
SKOTAREK Produkcja Maszyn Rolniczych i Części Jerzy Skotarek . . . . . . . . . . . . . . 97 . . . . . C 198
ROLMETAL Przedsiębiorstwo Produkcyjno Handlowe . . . . . . . . . . . . . . . . . . . . 92 . . . . . A 172
MICHALAK PRZEDSIĘBIORSTWO PRODUKCYJNO-HANDLOWO-USŁUGOWE . . . . . . . . 75 . . . . . . A 10
MOSKIT PRZEDSIĘBIORSTWO PRODUKCYJNO USŁUGOWO HANDLOWE . . . . . . . . . . MANDAM SP. Z O.O. PRZEDSIĘBIORSTWO PRODUKCYJNO HANDLOWE . . . . . . . . . .
LEMKEN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KORBANEK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KÖCKERLING GmbH & Co. KG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . GRANO-SYSTEM ILONA KULETA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . HENRYK Firma Henryk Batyra . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
GREGOIRE-BESSON POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . .
EXPOM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . DAL-BO A/S . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ALOIS PÖTTINGER Maschinenfabrik GmbH . . . . . . . . . . . . . . . . . . . . . . . . . 76 . . . . . C 193
70 . . . . . D 224
68 . . . . . F 308
65 . . . . . B 269
64 . . . . . B 189
49 . . . . . . B 21
52 . . . . . F 259
49 . . . . . E 295
41 . . . . . C 276
33 . . . . . A 173
16 . . . . . C 281
0306 Kompaktowe brony talerzowe/Short disc harrows
AGRISEM INTERNATIONAL S.A.S. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 . . . . . F 306
BURY MASZYNY ROLNICZE - WOJCIECH BURY . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . F 301
BIURO DORADCZO-HANDLOWE JACEK KRÓL . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . E 236
BEDNAR FMT s.r.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . F 310
UNIA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . C 278
VOGEL&NOOT Polska Sławomir Langner . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . D 223
VÄDERSTAD Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 109 . . . . . F 309
ROLMAKO P.H.U.T.P. HENRYK KOWALSKI . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . A 176
STALTECH Grzegorz Dobrzański . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 . . . . . B 181
HORSCH MASCHINEN GMBH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . F 307
MANDAM SP. Z O.O. PRZEDSIĘBIORSTWO PRODUKCYJNO HANDLOWE . . . . . . . . . . 70 . . . . . D 224
LEMKEN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . F 308
GRANO-SYSTEM ILONA KULETA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . . B 21
GREGOIRE-BESSON POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . E 295
DAL-BO A/S . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . A 173
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . F 305
0307 Brony zębowe/Field and crop harrows
AGROMAX S.C. Stanisław Osek, Tomasz Osek . . . . . . . . . . . . . . . . . . . . . . . 11 . . . . . C 197
APV POLSKA DANUTA MŁOCEK-BIEŻUŃSKA . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . . B 37
BAGRAMET SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . B 185
Branżowy spis wystawców
nr str.
stoisko
BIURO DORADCZO-HANDLOWE JACEK KRÓL . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . E 236
WOPROL PRZEDSIĘBIORSTWO PRODUKCYJNO-USŁUGOWO-HANDLOWE Jerzy Worek . . 113 . . . . . C 208
SALIDA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . C 402
PROMAR - Zakład Produkcji Maszyn Rolniczych Dariusz Nowak . . . . . . . . . . . . . . .
PRACOWNICZY OŚRODEK MASZYNOWY W AUGUSTOWIE Sp. z o.o. . . . . . . . . . . . . CLAYDON . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
LEMKEN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
GRANO-SYSTEM ILONA KULETA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87 . . . . . C 196
86 . . . . . C 276
32 . . . . . A 170
68 . . . . . F 308
49 . . . . . . B 21
EXPOM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41 . . . . . C 276
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
0308 Brony wirnikowe/Rotary harrows
AGROTIMH Tomasz Iwaszkiewicz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 . . . . . D 215
BIURO DORADCZO-HANDLOWE JACEK KRÓL . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . E 236
CELLI S.p.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . . B 28
CENTRUM TECHNIKI ROLNICZEJ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 31 . . . . . C 507
UNIROL PARTS SP. Z O.O. SP.K. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . . C 48
VOGEL&NOOT Polska Sławomir Langner . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . D 223
SALIDA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . C 402
LEMKEN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . F 308
SERAFIN P.U.H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . D 294
GEO Di BOERI GIOVANNA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47 . . . . . . . A 2
GREGOIRE-BESSON POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . E 295
ALOIS PÖTTINGER Maschinenfabrik GmbH . . . . . . . . . . . . . . . . . . . . . . . . . 16 . . . . . C 281
AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . F 305
0309 Glebogryzarki/Rotavators
AGROTIMH Tomasz Iwaszkiewicz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 . . . . . D 215
APH GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . C 524
BAGRAMET SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . B 185
CELLI S.p.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . . B 28
CENTRUM TECHNIKI ROLNICZEJ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 31 . . . . . C 507
UNIROL PARTS SP. Z O.O. SP.K. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . . C 48
PROGRASS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87 . . . . . . . A 3
PREMIUM TRADE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . . B 38
NDS-GRZEGORZ MICHAŁEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 . . . . . B 177
KELLFRI SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 62 . . . . . E 235
SERAFIN P.U.H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . D 294
HUSQVARNA POLAND SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . F 242
DAL-BO A/S . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . A 173
AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . F 305
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
0310 Wały uprawowe/Rollers
AGRO-MIX PRODUCENT MASZYN ROLNICZYCH SOBAŃSKA ZOFIA . . . . . . . . . . . . . 12 . . . . . . A 13
BURY MASZYNY ROLNICZE - WOJCIECH BURY . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . F 301
VOGEL&NOOT Polska Sławomir Langner . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . D 223
VÄDERSTAD Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 109 . . . . . F 309
ROLMAKO P.H.U.T.P. HENRYK KOWALSKI . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . A 176
HORSCH MASCHINEN GMBH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
OPALL-AGRI s.r.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MICHALAK PRZEDSIĘBIORSTWO PRODUKCYJNO-HANDLOWO-USŁUGOWE . . . . . . . . MANDAM SP. Z O.O. PRZEDSIĘBIORSTWO PRODUKCYJNO HANDLOWE . . . . . . . . . .
LEMKEN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KÖCKERLING GmbH & Co. KG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . GRANO-SYSTEM ILONA KULETA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . F 307
79 . . . . . . B 25
75 . . . . . . A 10
70 . . . . . D 224
68 . . . . . F 308
64 . . . . . B 189
49 . . . . . . B 21
HENRYK Firma Henryk Batyra . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52 . . . . . F 259
EXPOM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41 . . . . . C 276
DAL-BO A/S . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . A 173
0311 Agregaty do uprawy przedsiewnej/Seedbed combination
AGRO-MIX PRODUCENT MASZYN ROLNICZYCH SOBAŃSKA ZOFIA . . . . . . . . . . . . . 12 . . . . . . A 13
AGRO-MASZ Paweł Nowak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11 . . . . . A 168
AGRISEM INTERNATIONAL S.A.S. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 . . . . . F 306
BAGRAMET SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . B 185
BURY MASZYNY ROLNICZE - WOJCIECH BURY . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . F 301
BEDNAR FMT s.r.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . F 310
UNIROL PARTS SP. Z O.O. SP.K. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . . C 48
VOGEL&NOOT Polska Sławomir Langner . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . D 223
VÄDERSTAD Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 109 . . . . . F 309
WOPROL PRZEDSIĘBIORSTWO PRODUKCYJNO-USŁUGOWO-HANDLOWE Jerzy Worek . . 113 . . . . . C 208
SIPMA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97 . . . . . C 212
STALTECH Grzegorz Dobrzański . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 . . . . . B 181
SKOTAREK Produkcja Maszyn Rolniczych i Części Jerzy Skotarek . . . . . . . . . . . . . . 97 . . . . . C 198
ROLMETAL Przedsiębiorstwo Produkcyjno Handlowe . . . . . . . . . . . . . . . . . . . . 92 . . . . . A 172
PNEUSEJ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83 . . . . . . B 26
NAJBAR F. H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 . . . . . F 252
OPALL-AGRI s.r.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 . . . . . . B 25
MOSKIT PRZEDSIĘBIORSTWO PRODUKCYJNO USŁUGOWO HANDLOWE . . . . . . . . . . MANDAM SP. Z O.O. PRZEDSIĘBIORSTWO PRODUKCYJNO HANDLOWE . . . . . . . . . .
LEMKEN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KÖCKERLING GmbH & Co. KG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . GRANO-SYSTEM ILONA KULETA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 76 . . . . . C 193
70 . . . . . D 224
68 . . . . . F 308
64 . . . . . B 189
49 . . . . . . B 21
HENRYK Firma Henryk Batyra . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52 . . . . . F 259
Branżowy spis wystawców
nr str.
stoisko
GREGOIRE-BESSON POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . E 295
EXPOM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41 . . . . . C 276
DAL-BO A/S . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . A 173
DURO-FRANCE / AGRI-CONSULT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 37 . . . . . D 213
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
S.C. TOMIT AGRI MACCHINE SRL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . DEXWAL BIS PPUH Dorota Walkiewicz . . . . . . . . . . . . . . . . . . . . . . . . . . . AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . . . .
JUNKKARI POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
93 . . . . . E 605
35 . . . . . E 588
17 . . . . . F 305
60 . . . . . D 294
0312 Technika minimalnej uprawy roli/Minimum soil cultivation technology
AGRISEM INTERNATIONAL S.A.S. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 . . . . . F 306
BEDNAR FMT s.r.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . F 310
VÄDERSTAD Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 109 . . . . . F 309
STAL IMPEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 . . . . . D 542
HORSCH MASCHINEN GMBH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . F 307
LEMKEN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . F 308
KÖCKERLING GmbH & Co. KG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64 . . . . . B 189
EXPOM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41 . . . . . C 276
DAL-BO A/S . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . A 173
DURO-FRANCE / AGRI-CONSULT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 37 . . . . . D 213
S.C. TOMIT AGRI MACCHINE SRL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . E 605
AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . F 305
0313 Brony łąkowe/Chain-link harrows
CRYSTAL TRAKTOR Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . METALINVEST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . MANDAM SP. Z O.O. PRZEDSIĘBIORSTWO PRODUKCYJNO HANDLOWE . . . . . . . . . .
KÖCKERLING GmbH & Co. KG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . JANSSEN POLAND Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
GRANO-SYSTEM ILONA KULETA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . D 287
74 . . . . . C 206
70 . . . . . D 224
64 . . . . . B 189
59 . . . . . E 229
49 . . . . . . B 21
EXPOM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41 . . . . . C 276
DAL-BO A/S . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . A 173
ATMP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20 . . . . . . A 12
0314 Maszyny uprawowe - części/Accessories for soil working equipment
ATW S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21 . . . . . E 226
AGROBERG Renata i Stanisław Berg S.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 . . . . . D 101
AGROGRUPA BOŻENA DRABEK SPÓŁKA KOMANDYTOWO-AKCYJNA . . . . . . . . . . . . 10 . . . . . F 154
BAGRAMET SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . B 185
BEDNAR FMT s.r.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . F 310
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
CELLI S.p.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . . B 28
ZAKŁAD MECHANIZMÓW NAPĘDOWYCH S.C. Gabryjela Szydłowska Roman Tański . . . . 114 . . . . . F 140
ZETOR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . E 297
UNIA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . C 278
UNIROL PARTS SP. Z O.O. SP.K. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . . C 48
VOGEL&NOOT Polska Sławomir Langner . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . D 223
SALIDA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . C 402
SOLAN T.CZECH, Ł.CZECH Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98 . . . . . C 521
SKOTAREK Produkcja Maszyn Rolniczych i Części Jerzy Skotarek . . . . . . . . . . . . . . 97 . . . . . C 198
HORSCH MASCHINEN GMBH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . F 307
NDS-GRZEGORZ MICHAŁEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 . . . . . B 177
OPALL-AGRI s.r.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 . . . . . . B 25
OTTO TH. MENKE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . . C 45
MICHALAK PRZEDSIĘBIORSTWO PRODUKCYJNO-HANDLOWO-USŁUGOWE . . . . . . . . 75 . . . . . . A 10
LEMKEN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . F 308
K i J S.C. Przedsiębiorstwo Wielobranżowe . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . . D 95
KÖCKERLING GmbH & Co. KG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64 . . . . . B 189
KAGRO Krzysztof Pankowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . B 188
INDUSTRIEHOF SCHERENBOSTEL HEINRICH RODENBOSTEL GmbH . . . . . . . . . . . . 56 . . . . . . C 46
GRANO-SYSTEM ILONA KULETA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . . B 21
DAL-BO A/S . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . A 173
DUAL System . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 37 . . . . . F 255
WYRÓB GALANTERII Z METALU WALTERSCHEID-SERVICE . . . . . . . . . . . . . . . . . 113 . . . . . A 263
AGRO-EKO P.W. Grzegorz Pilch . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . A 263
ATMP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20 . . . . . . A 12
ALOIS PÖTTINGER Maschinenfabrik GmbH . . . . . . . . . . . . . . . . . . . . . . . . . 16 . . . . . C 281
AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . F 305
0401 Siewniki, sadzarki, pielniki/Seed drills, planters, hoes
AGRONOMIK POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . C 192
AGROMA Przesiębiorstwo Handlowe S.A. w Poznaniu . . . . . . . . . . . . . . . . . . . . 11 . . . . . A 171
ARIKON-AGRO Przedsiębiorstwo Wielobranżowe . . . . . . . . . . . . . . . . . . . . . . 19 . . . . . C 516
AGROTIMH Tomasz Iwaszkiewicz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 . . . . . D 215
APH GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . C 524
AGROMIX PUP Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 . . . . . A 263
UNIA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . C 278
POLBOTO-AGRI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83 . . . . . . D 79
SOLAN T.CZECH, Ł.CZECH Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98 . . . . . C 521
SOCIETE PROMODIS (SPÓŁKA AKCYJNA SPÓŁDZIELNIA) ODDZIAŁ W POLSCE . . . . . . . 98 . . . . . B 180
PRZEDSIĘBIORSTWO ROMANOWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . 88 . . . . . D 286
PREMIUM TRADE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . . B 38
Branżowy spis wystawców
nr str.
stoisko
NDS-GRZEGORZ MICHAŁEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . MASCAR SPA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ŁUCZAK MASZYNY ROLNICZE Stanisław Łuczak . . . . . . . . . . . . . . . . . . . . . . KORBANEK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KAGRO Krzysztof Pankowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 . . . . . B 177
71 . . . . . B 179
69 . . . . . F 240
65 . . . . . B 269
61 . . . . . B 188
S.C. TOMIT AGRI MACCHINE SRL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . E 605
0402 Siewniki/Seed drills
APV POLSKA DANUTA MŁOCEK-BIEŻUŃSKA . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . . B 37
AGROTIMH Tomasz Iwaszkiewicz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 . . . . . D 215
BERUTEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 . . . . . E 228
UNIROL PARTS SP. Z O.O. SP.K. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . . C 48
VOGEL&NOOT Polska Sławomir Langner . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . D 223
VÄDERSTAD Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 109 . . . . . F 309
SALIDA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . C 402
ROLMETAL Przedsiębiorstwo Produkcyjno Handlowe . . . . . . . . . . . . . . . . . . . . 92 . . . . . A 172
PERKOZ PRZEDSIĘBIORSTWO HANDLOWO-USŁUGOWE Sp. z o.o. . . . . . . . . . . . . . 80 . . . . . B 184
PNEUSEJ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83 . . . . . . B 26
NDS-GRZEGORZ MICHAŁEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 . . . . . B 177
MASCAR SPA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . B 179
LEMKEN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . F 308
ŁUCZAK MASZYNY ROLNICZE Stanisław Łuczak . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . F 240
GREGOIRE-BESSON POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . E 295
DAL-BO A/S . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . A 173
DURO-FRANCE / AGRI-CONSULT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 37 . . . . . D 213
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
ALOIS PÖTTINGER Maschinenfabrik GmbH . . . . . . . . . . . . . . . . . . . . . . . . . 16 . . . . . C 281
AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . F 305
JUNKKARI POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 294
0403 Agregaty uprawowo-siewne/Seed drill combinations
APV POLSKA DANUTA MŁOCEK-BIEŻUŃSKA . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . . B 37
AGRISEM INTERNATIONAL S.A.S. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 . . . . . F 306
BAGRAMET SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . B 185
CENTRUM TECHNIKI ROLNICZEJ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 31 . . . . . C 507
UNIROL PARTS SP. Z O.O. SP.K. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . . C 48
VOGEL&NOOT Polska Sławomir Langner . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . D 223
VÄDERSTAD Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 109 . . . . . F 309
WOPROL PRZEDSIĘBIORSTWO PRODUKCYJNO-USŁUGOWO-HANDLOWE Jerzy Worek . . 113 . . . . . C 208
ROLMAKO P.H.U.T.P. HENRYK KOWALSKI . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . A 176
TAD-LEN PPHU Światła Tadeusz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 102 . . . . . C 195
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
SALIDA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . C 402
STALTECH Grzegorz Dobrzański . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 . . . . . B 181
SKOTAREK Produkcja Maszyn Rolniczych i Części Jerzy Skotarek . . . . . . . . . . . . . . 97 . . . . . C 198
HORSCH MASCHINEN GMBH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . F 307
MICHALAK PRZEDSIĘBIORSTWO PRODUKCYJNO-HANDLOWO-USŁUGOWE . . . . . . . . 75 . . . . . . A 10
MASCAR SPA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . B 179
ARMASZ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 . . . . . . A 15
LEMKEN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . F 308
ŁUCZAK MASZYNY ROLNICZE Stanisław Łuczak . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . F 240
KORBANEK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65 . . . . . B 269
KÖCKERLING GmbH & Co. KG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64 . . . . . B 189
GREGOIRE-BESSON POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . E 295
DAL-BO A/S . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . A 173
DURO-FRANCE / AGRI-CONSULT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 37 . . . . . D 213
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . F 305
JUNKKARI POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 294
0404 Siewniki do siewu w mulcz/Mulch drilling machines
VÄDERSTAD Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 109 . . . . . F 309
HORSCH MASCHINEN GMBH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . F 307
KÖCKERLING GmbH & Co. KG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64 . . . . . B 189
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . F 305
LEMKEN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . F 308
0405 Siewniki do siewu bezpośredniego/Direct seed drills
AGRISEM INTERNATIONAL S.A.S. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 . . . . . F 306
UNIROL PARTS SP. Z O.O. SP.K. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . . C 48
VÄDERSTAD Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 109 . . . . . F 309
PREMIUM TRADE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . . B 38
CLAYDON . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . A 170
LEMKEN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . F 308
ŁUKOMET KRZYSZTOF ŁUSZCZYK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . C 202
KÖCKERLING GmbH & Co. KG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64 . . . . . B 189
DURO-FRANCE / AGRI-CONSULT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 37 . . . . . D 213
AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . F 305
JUNKKARI POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 294
0406 Siewniki - osprzęt i części/Seed drills - accessories and spare parts
AGROBERG Renata i Stanisław Berg S.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 . . . . . D 101
Branżowy spis wystawców
nr str.
stoisko
AGROGRUPA BOŻENA DRABEK SPÓŁKA KOMANDYTOWO-AKCYJNA . . . . . . . . . . . . 10 . . . . . F 154
ZAKŁAD MECHANIZMÓW NAPĘDOWYCH S.C. Gabryjela Szydłowska Roman Tański . . . . 114 . . . . . F 140
UNIROL PARTS SP. Z O.O. SP.K. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . . C 48
SALIDA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PNEUSEJ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . MASCAR SPA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
LEMKEN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KÖCKERLING GmbH & Co. KG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . INDUSTRIEHOF SCHERENBOSTEL HEINRICH RODENBOSTEL GmbH . . . . . . . . . . . . DUAL System . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . . . .
JUNKKARI POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
93 . . . . . C 402
83 . . . . . . B 26
71 . . . . . B 179
68 . . . . . F 308
64 . . . . . B 189
56 . . . . . . C 46
37 . . . . . F 255
17 . . . . . F 305
60 . . . . . D 294
0407 Siewniki punktowe/Spacing drills
WEREMCZUK FMR Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . C 526
UNIROL PARTS SP. Z O.O. SP.K. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . . C 48
VÄDERSTAD Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 109 . . . . . F 309
SOLAN T.CZECH, Ł.CZECH Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98 . . . . . C 521
HORSCH MASCHINEN GMBH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . F 307
PREMIUM TRADE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . . B 38
NDS-GRZEGORZ MICHAŁEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 . . . . . B 177
NAJBAR F. H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 . . . . . F 252
MASCAR SPA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . B 179
DURO-FRANCE / AGRI-CONSULT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 37 . . . . . D 213
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . F 305
0408 Sadzarki do ziemniaków/Potato planters
AGRONOMIK POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . C 192
APH GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . C 524
TEHNOS d.o.o. Zalec . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104 . . . . . C 595
REMPRODEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 90 . . . . . F 253
ŁUCZAK MASZYNY ROLNICZE Stanisław Łuczak . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . F 240
GRIMME LANDMASCHINENFABRIK GmbH & Co.KG . . . . . . . . . . . . . . . . . . . . 49 . . . . . C 279
0409 Sadzarki do rozsady/Transplanters
AGROMAX S.C. Stanisław Osek, Tomasz Osek . . . . . . . . . . . . . . . . . . . . . . . 11 . . . . . C 197
AGROTIMH Tomasz Iwaszkiewicz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 . . . . . D 215
WEREMCZUK FMR Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . C 526
SOLAN T.CZECH, Ł.CZECH Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98 . . . . . C 521
NDS-GRZEGORZ MICHAŁEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 . . . . . B 177
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
NAJBAR F. H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 . . . . . F 252
KUJAWSKA FABRYKA MASZYN ROLNICZYCH Sp. z o.o. . . . . . . . . . . . . . . . . . . . 67 . . . . . C 203
ŁUCZAK MASZYNY ROLNICZE Stanisław Łuczak . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . F 240
0410 Pielniki/Mechanical hoes
AGAT Przedsiębiorstwo Wielobranżowe Piotr Jasiński . . . . . . . . . . . . . . . . . . . .
AGRONOMIK POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . SOLAN T.CZECH, Ł.CZECH Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
NDS-GRZEGORZ MICHAŁEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ŁUCZAK MASZYNY ROLNICZE Stanisław Łuczak . . . . . . . . . . . . . . . . . . . . . . EXPOM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ROLKAP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 . . . . . C 506
13 . . . . . C 192
98 . . . . . C 521
77 . . . . . B 177
69 . . . . . F 240
41 . . . . . C 276
91 . . . . . E 576
0411 Obsypniki/Ridging ploughs
AGRONOMIK POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . APH GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
SOLAN T.CZECH, Ł.CZECH Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
REMPRODEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KAGRO Krzysztof Pankowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . GRIMME LANDMASCHINENFABRIK GmbH & Co.KG . . . . . . . . . . . . . . . . . . . . 13 . . . . . C 192
18 . . . . . C 524
98 . . . . . C 521
90 . . . . . F 253
61 . . . . . B 188
49 . . . . . C 279
0501 Maszyny do nawożenia/Fertilizer application
AGROMA Przesiębiorstwo Handlowe S.A. w Poznaniu . . . . . . . . . . . . . . . . . . . . 11 . . . . . A 171
APV POLSKA DANUTA MŁOCEK-BIEŻUŃSKA . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . . B 37
AGROMIX PUP Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 . . . . . A 263
CMKS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . C 210
UNIA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . C 278
POLBOTO-AGRI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83 . . . . . . D 79
SOLAN T.CZECH, Ł.CZECH Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98 . . . . . C 521
SCHUITEMAKER MACHINES B.V. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . E 131
SOCIETE PROMODIS (SPÓŁKA AKCYJNA SPÓŁDZIELNIA) ODDZIAŁ W POLSCE . . . . . . . 98 . . . . . B 180
ROLTRANS PHUP WALDEMAR KOBYLIŃSKI . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . F 251
POL-STRAUTMANN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 85 . . . . . A 175
PRZEDSIĘBIORSTWO ROMANOWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . 88 . . . . . D 286
KAGRO Krzysztof Pankowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . B 188
JOSKIN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 289
DAL-BO A/S . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . A 173
POMOT PUP SP. Z O.O. (Chojna) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . C 276
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
Branżowy spis wystawców
nr str.
stoisko
0502 Technika składowania, transportu i załadunku nawozów mineralnych
/Fertilizers, storage, conveying and transportation technology
BÜHLER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28 . . . . . C 401
DENIS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . E 298
STAL IMPEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 . . . . . D 542
ROLKAP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . E 576
0503 Rozsiewacze nawozów mineralnych/Mineral fertilizer spreaders
APV POLSKA DANUTA MŁOCEK-BIEŻUŃSKA . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . . B 37
ALTRO FPH JANUSZ WOŹNIAK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16 . . . . . . C 72
ANDERWALD MASZYNY ROLNICZE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . . . A 4
BAGRAMET SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . B 185
BONDIOLI & PAVESI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . . . C 61
BAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . D 422
CAMARA POLONIA JESUS MANUEL CAMARA PEREZ . . . . . . . . . . . . . . . . . . . . 30 . . . . . E 230
UNIA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . C 278
UNIROL PARTS SP. Z O.O. SP.K. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . . C 48
WOPROL PRZEDSIĘBIORSTWO PRODUKCYJNO-USŁUGOWO-HANDLOWE Jerzy Worek . . 113 . . . . . C 208
TEHNOS d.o.o. Zalec . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104 . . . . . C 595
SALIDA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . C 402
SIPMA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97 . . . . . C 212
SOLAN T.CZECH, Ł.CZECH Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98 . . . . . C 521
PROMAR - Zakład Produkcji Maszyn Rolniczych Dariusz Nowak . . . . . . . . . . . . . . . 87 . . . . . C 196
PREMIUM TRADE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . . B 38
PRACOWNICZY OŚRODEK MASZYNOWY W AUGUSTOWIE Sp. z o.o. . . . . . . . . . . . . 86 . . . . . C 276
MECHANIKA MASZYN I URZĄDZEŃ ROLNICZYCH TOMASZ PINKOWSKI . . . . . . . . . . . 72 . . . . . E 116
KORBANEK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65 . . . . . B 269
KELLFRI SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 62 . . . . . E 235
JOSKIN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 289
POMOT PUP SP. Z O.O. (Chojna) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . C 276
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
ENERGETYK-SERWIS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 40 . . . . . F 164
DEXWAL BIS PPUH Dorota Walkiewicz . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . E 588
AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . F 305
0504 Rozrzutniki wapna/Lime spreaders
A-LIMA-BIS Przedsiębiorstwo Produkcyjno-Handlowo-Usługowe Sp. z o.o. . . . . . . . . . 16 . . . . . D 221
BERUTEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 . . . . . E 228
BAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . D 422
UNIA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . C 278
SALIDA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . C 402
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
SCHUITEMAKER MACHINES B.V. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ROLTRANS PHUP WALDEMAR KOBYLIŃSKI . . . . . . . . . . . . . . . . . . . . . . . . .
POL-STRAUTMANN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
LUDWIG BERGMANN GmbH Maschinenfabrik . . . . . . . . . . . . . . . . . . . . . . . .
JOSKIN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . E 131
93 . . . . . F 251
85 . . . . . A 175
69 . . . . . F 258
60 . . . . . D 289
FLIEGL AGRARTECHNIK GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . D 220
POMOT PUP SP. Z O.O. (Chojna) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . C 276
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
DAF AGRO - ANDO TECH Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . E 600
ANNABURGER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . E 581
AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . F 305
0505 Rozrzutniki obornika/Manure spreaders
AGRARSAM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 . . . . . E 234
A-LIMA-BIS Przedsiębiorstwo Produkcyjno-Handlowo-Usługowe Sp. z o.o. . . . . . . . . . 16 . . . . . D 221
BERUTEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 . . . . . E 228
BAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . D 422
CAMARA POLONIA JESUS MANUEL CAMARA PEREZ . . . . . . . . . . . . . . . . . . . . 30 . . . . . E 230
UNIA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . C 278
UNIROL PARTS SP. Z O.O. SP.K. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . . C 48
SIPMA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97 . . . . . C 212
SCHUITEMAKER MACHINES B.V. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . E 131
ROLTRANS PHUP WALDEMAR KOBYLIŃSKI . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . F 251
POL-STRAUTMANN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 85 . . . . . A 175
PICHON S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 . . . . . B 183
LUDWIG BERGMANN GmbH Maschinenfabrik . . . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . F 258
JOSKIN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 289
FLIEGL AGRARTECHNIK GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . D 220
GREGOIRE-BESSON POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . E 295
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
DAF AGRO - ANDO TECH Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . E 600
ANNABURGER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . E 581
0506 Rozlewacze gnojowicy i ich wyposażenie/Slurry spreaders and accessories
A-LIMA-BIS Przedsiębiorstwo Produkcyjno-Handlowo-Usługowe Sp. z o.o. . . . . . . . . .
BERUTEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BONDIOLI & PAVESI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . BAUER GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . BINOTTO POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . BAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . CAMARA POLONIA JESUS MANUEL CAMARA PEREZ . . . . . . . . . . . . . . . . . . . .
16 . . . . . D 221
24 . . . . . E 228
27 . . . . . . C 61
23 . . . . . C 201
25 . . . . . F 138
22 . . . . . D 422
30 . . . . . E 230
Branżowy spis wystawców
nr str.
stoisko
WIELTON S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 112 . . . . . B 190
SIPMA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97 . . . . . C 212
PICHON S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 . . . . . B 183
MEPROZET KOŚCIAN S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . D 293
ŁUKOMET KRZYSZTOF ŁUSZCZYK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . C 202
JOSKIN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 289
FLIEGL AGRARTECHNIK GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . D 220
GREGOIRE-BESSON POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . E 295
POMOT PUP SP. Z O.O. (Chojna) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . C 276
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
S.C. TOMIT AGRI MACCHINE SRL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . E 605
ANNABURGER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . E 581
0507 Rozlewacze nawozów płynnych/Liquid fertilization
BAUER GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . BINOTTO POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . BAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . CAMARA POLONIA JESUS MANUEL CAMARA PEREZ . . . . . . . . . . . . . . . . . . . .
JOSKIN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . C 201
25 . . . . . F 138
22 . . . . . D 422
30 . . . . . E 230
60 . . . . . D 289
FLIEGL AGRARTECHNIK GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . D 220
EKOTRONIC Marek Janus . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 38 . . . . . C 281
ANNABURGER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . E 581
0508 Maszyny do nawożenia - osprzęt i części/Fertilizer spreaders Accessories and spare parts
ATW S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21 . . . . . E 226
AGROBERG Renata i Stanisław Berg S.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 . . . . . D 101
AGROGRUPA BOŻENA DRABEK SPÓŁKA KOMANDYTOWO-AKCYJNA . . . . . . . . . . . .
BONDIOLI & PAVESI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . BAUER GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . BINOTTO POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . SOLAN T.CZECH, Ł.CZECH Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ROLNICTWO PRECYZYJNE ANDRZEJ PRZEPERSKI . . . . . . . . . . . . . . . . . . . . . POL-STRAUTMANN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MECHANIKA MASZYN I URZĄDZEŃ ROLNICZYCH TOMASZ PINKOWSKI . . . . . . . . . . .
OTTO TH. MENKE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . PRECYZYJNEROLNICTWO.COM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KAGRO Krzysztof Pankowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . JOSKIN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . INDUSTRIEHOF SCHERENBOSTEL HEINRICH RODENBOSTEL GmbH . . . . . . . . . . . . POMOT PUP SP. Z O.O. (Chojna) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . DUAL System . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
10 . . . . . F 154
27 . . . . . . C 61
23 . . . . . C 201
25 . . . . . F 138
98 . . . . . C 521
92 . . . . . . D 96
85 . . . . . A 175
72 . . . . . E 116
73 . . . . . . C 45
86 . . . . . D 109
61 . . . . . B 188
60 . . . . . D 289
56 . . . . . . C 46
86 . . . . . C 276
37 . . . . . F 255
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
DEXWAL BIS PPUH Dorota Walkiewicz . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . E 588
AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . F 305
0601 Technika ochrony roślin/Plant protection
AGROMA Przesiębiorstwo Handlowe S.A. w Poznaniu . . . . . . . . . . . . . . . . . . . .
AGROMIX PUP Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . BARTNIK TECHNICZNE WYPOSAŻENIE ROLNICTWA BOGUSŁAW BARTNIK . . . . . . . . . BIURO DORADCZO-HANDLOWE JACEK KRÓL . . . . . . . . . . . . . . . . . . . . . . . .
BONDIOLI & PAVESI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11 . . . . . A 171
12 . . . . . A 263
23 . . . . . . C 60
26 . . . . . E 236
27 . . . . . . C 61
POLBOTO-AGRI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83 . . . . . . D 79
SOCIETE PROMODIS (SPÓŁKA AKCYJNA SPÓŁDZIELNIA) ODDZIAŁ W POLSCE . . . . . . . 98 . . . . . B 180
REMSZ KLIMCZAK Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 90 . . . . . . C 68
PRZEDSIĘBIORSTWO ROMANOWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . 88 . . . . . D 286
MESCOMP-OPRYSKIWACZE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74 . . . . . C 194
PRECYZYJNEROLNICTWO.COM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . D 109
LEMKEN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . F 308
KAGRO Krzysztof Pankowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . B 188
EKOTRONIC Marek Janus . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 38 . . . . . C 281
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
S.C. TOMIT AGRI MACCHINE SRL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . E 605
AGRIO MODERNI ZEMEDELSKE SLUZBY s.r.o. . . . . . . . . . . . . . . . . . . . . . . . . 7 . . . . . F 303
0602 Opryskiwacze polowe/Field sprayers
ATW S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21 . . . . . E 226
AGRONOMIK POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . C 192
AGROMAX S.C. Stanisław Osek, Tomasz Osek . . . . . . . . . . . . . . . . . . . . . . . 11 . . . . . C 197
AGROLA Zakład Handlowo-Produkcyjny Zdzisław Niegowski . . . . . . . . . . . . . . . . 10 . . . . . . C 56
AGRIFAC MACHINERY B.V. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 . . . . . E 299
BURY MASZYNY ROLNICZE - WOJCIECH BURY . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . F 301
BRANDI P.P.H.U. JACEK KARCZMARCZYK . . . . . . . . . . . . . . . . . . . . . . . . . . 28 . . . . . . C 58
BIURO DORADCZO-HANDLOWE JACEK KRÓL . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . E 236
BONDIOLI & PAVESI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . . . C 61
UNIA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . C 278
UNIROL PARTS SP. Z O.O. SP.K. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . . C 48
VOGEL&NOOT Polska Sławomir Langner . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . D 223
WOPROL PRZEDSIĘBIORSTWO PRODUKCYJNO-USŁUGOWO-HANDLOWE Jerzy Worek . . 113 . . . . . C 208
TAD-LEN PPHU Światła Tadeusz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 102 . . . . . C 195
STANIMPEX MACIEJ PACKIEWICZ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 . . . . . . C 57
SKOTAREK Produkcja Maszyn Rolniczych i Części Jerzy Skotarek . . . . . . . . . . . . . . 97 . . . . . C 198
HORSCH MASCHINEN GMBH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . F 307
PROMAR - Zakład Produkcji Maszyn Rolniczych Dariusz Nowak . . . . . . . . . . . . . . . 87 . . . . . C 196
Branżowy spis wystawców
nr str.
stoisko
PREMIUM TRADE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
METALINVEST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . NDS-GRZEGORZ MICHAŁEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . MOSKIT PRZEDSIĘBIORSTWO PRODUKCYJNO USŁUGOWO HANDLOWE . . . . . . . . . . 86 . . . . . . B 38
74 . . . . . C 206
77 . . . . . B 177
76 . . . . . C 193
MESCOMP-OPRYSKIWACZE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74 . . . . . C 194
KUJAWSKA FABRYKA MASZYN ROLNICZYCH Sp. z o.o. . . . . . . . . . . . . . . . . . . . 67 . . . . . C 203
LEMKEN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . F 308
KORBANEK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65 . . . . . B 269
GREGOIRE-BESSON POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . E 295
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
AGROMEHANIKA d.d. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11 . . . . . C 595
S.C. TOMIT AGRI MACCHINE SRL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . E 605
AGRIO MODERNI ZEMEDELSKE SLUZBY s.r.o. . . . . . . . . . . . . . . . . . . . . . . . . 7 . . . . . F 303
ZAKŁAD MECHANIKI MASZYN I URZĄDZEŃ ROLNICZYCH SŁAWOMIR BIARDZKI . . . . . . 114 . . . . . . C 59
AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . F 305
0603 Opryskiwacze sadownicze i warzywnicze/Orchard and vegetable sprayers
Z.H.U. ARGO PAWEŁ KALIŃSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 113 . . . . . . C 67
AGRONOMIK POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . C 192
AGROLA Zakład Handlowo-Produkcyjny Zdzisław Niegowski . . . . . . . . . . . . . . . . 10 . . . . . . C 56
BURY MASZYNY ROLNICZE - WOJCIECH BURY . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . F 301
BIURO DORADCZO-HANDLOWE JACEK KRÓL . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . E 236
BONDIOLI & PAVESI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . . . C 61
WOPROL PRZEDSIĘBIORSTWO PRODUKCYJNO-USŁUGOWO-HANDLOWE Jerzy Worek . . 113 . . . . . C 208
TAD-LEN PPHU Światła Tadeusz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 102 . . . . . C 195
SOLAN T.CZECH, Ł.CZECH Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98 . . . . . C 521
METALINVEST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74 . . . . . C 206
MAROLEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . . C 64
NDS-GRZEGORZ MICHAŁEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 . . . . . B 177
MOSKIT PRZEDSIĘBIORSTWO PRODUKCYJNO USŁUGOWO HANDLOWE . . . . . . . . . . 76 . . . . . C 193
MARKET ROLNICZY MINGE SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . A 317
KUJAWSKA FABRYKA MASZYN ROLNICZYCH Sp. z o.o. . . . . . . . . . . . . . . . . . . . 67 . . . . . C 203
GREGOIRE-BESSON POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . E 295
AGROMEHANIKA d.d. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11 . . . . . C 595
0604 Opryskiwacze - osprzęt i części/Sprayers equipment and accessories
Z.H.U. ARGO PAWEŁ KALIŃSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 113 . . . . . . C 67
ATW S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21 . . . . . E 226
AGROLA Zakład Handlowo-Produkcyjny Zdzisław Niegowski . . . . . . . . . . . . . . . . 10 . . . . . . C 56
AGROGRUPA BOŻENA DRABEK SPÓŁKA KOMANDYTOWO-AKCYJNA . . . . . . . . . . . . 10 . . . . . F 154
BARTNIK TECHNICZNE WYPOSAŻENIE ROLNICTWA BOGUSŁAW BARTNIK . . . . . . . . . 23 . . . . . . C 60
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
BURY MASZYNY ROLNICZE - WOJCIECH BURY . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . F 301
BIURO DORADCZO-HANDLOWE JACEK KRÓL . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . E 236
BONDIOLI & PAVESI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . . . C 61
UNIROL PARTS SP. Z O.O. SP.K. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . . C 48
WOPROL PRZEDSIĘBIORSTWO PRODUKCYJNO-USŁUGOWO-HANDLOWE Jerzy Worek . . 113 . . . . . C 208
TAD-LEN PPHU Światła Tadeusz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 102 . . . . . C 195
SKOTAREK Produkcja Maszyn Rolniczych i Części Jerzy Skotarek . . . . . . . . . . . . . . 97 . . . . . C 198
ROLNICTWO PRECYZYJNE ANDRZEJ PRZEPERSKI . . . . . . . . . . . . . . . . . . . . . 92 . . . . . . D 96
MAROLEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . . C 64
OTTO TH. MENKE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . . C 45
MESCOMP-OPRYSKIWACZE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74 . . . . . C 194
MARKET ROLNICZY MINGE SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . A 317
LEMKEN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . F 308
GREGOIRE-BESSON POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . E 295
EKOTRONIC Marek Janus . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 38 . . . . . C 281
AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . F 305
0605 Zamgławiacze/Plant protection atomizers
UNIROL PARTS SP. Z O.O. SP.K. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . . C 48
MARKET ROLNICZY MINGE SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . A 317
0606 Rozsiewacze granulatów/Granule spreaders
VOGELSANG Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . C 200
SOLAN T.CZECH, Ł.CZECH Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98 . . . . . C 521
GREGOIRE-BESSON POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . E 295
POMOT PUP SP. Z O.O. (Chojna) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . C 276
DEXWAL BIS PPUH Dorota Walkiewicz . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . E 588
0607 Rozpylacze/Nozzles
BARTNIK TECHNICZNE WYPOSAŻENIE ROLNICTWA BOGUSŁAW BARTNIK . . . . . . . . . 23 . . . . . . C 60
BURY MASZYNY ROLNICZE - WOJCIECH BURY . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . F 301
BIURO DORADCZO-HANDLOWE JACEK KRÓL . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . E 236
BONDIOLI & PAVESI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . . . C 61
ALBUZ BOTT . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15 . . . . . . C 63
MESCOMP-OPRYSKIWACZE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74 . . . . . C 194
MMAT MARIAN MIKOŁAJCZAK AGRO TECHNOLOGY . . . . . . . . . . . . . . . . . . . . 76 . . . . . . C 62
LEMKEN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . F 308
KAGRO Krzysztof Pankowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . B 188
EKOTRONIC Marek Janus . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 38 . . . . . C 281
Branżowy spis wystawców
nr str.
stoisko
0701 Deszczowanie i nawadnianie/Sprinkler irrigation and surface irrigation
AQUA-ROL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . . C 70
BAYWA AG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . C 199
BAUER GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . C 201
POLBOTO-AGRI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83 . . . . . . D 79
PRZEDSIĘBIORSTWO ROMANOWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . 88 . . . . . D 286
NDS-GRZEGORZ MICHAŁEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 . . . . . B 177
ŁUKOMET KRZYSZTOF ŁUSZCZYK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . C 202
S.C. TOMIT AGRI MACCHINE SRL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . E 605
0702 Deszczownie i akcesoria do deszczowni/Sprinkler irrigation installations and accessories
AGRONOMIK POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . C 192
AQUA-ROL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . . C 70
BAYWA AG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . C 199
BEZALIN S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 . . . . hala 25
BAUER GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . C 201
NDS-GRZEGORZ MICHAŁEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 . . . . . B 177
ŁUKOMET KRZYSZTOF ŁUSZCZYK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . C 202
0703 Instalacje nawadniające i akcesoria/Irrigation installation and accessories
AGRONOMIK POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . C 192
AQUA-ROL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . . C 70
BAYWA AG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . C 199
BEZALIN S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 . . . . hala 25
BAUER GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . C 201
STAL IMPEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 . . . . . D 542
NDS-GRZEGORZ MICHAŁEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 . . . . . B 177
ŁUKOMET KRZYSZTOF ŁUSZCZYK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . C 202
0704 Technika drenowania/Drainage technology
AGRIFAC MACHINERY B.V. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 . . . . . E 299
BARTNIK TECHNICZNE WYPOSAŻENIE ROLNICTWA BOGUSŁAW BARTNIK . . . . . . . . . 23 . . . . . . C 60
BAYWA AG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . C 199
POLBOTO-AGRI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83 . . . . . . D 79
PRECYZYJNEROLNICTWO.COM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . D 109
UTECH Maszyny i Urządzenia Techniczne Norbert Koenig . . . . . . . . . . . . . . . . . . 108 . . . . . . A 17
0705 Pompy/Pumps
AGRONOMIK POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . C 192
AGROMOTOR Tadeusz Michalak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 . . . . . . C 65
AGROGRUPA BOŻENA DRABEK SPÓŁKA KOMANDYTOWO-AKCYJNA . . . . . . . . . . . . 10 . . . . . F 154
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
AQUA-ROL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . BARTNIK TECHNICZNE WYPOSAŻENIE ROLNICTWA BOGUSŁAW BARTNIK . . . . . . . . . BERUTEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BAYWA AG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . BIURO DORADCZO-HANDLOWE JACEK KRÓL . . . . . . . . . . . . . . . . . . . . . . . .
BONDIOLI & PAVESI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . . C 70
23 . . . . . . C 60
24 . . . . . E 228
23 . . . . . C 199
26 . . . . . E 236
27 . . . . . . C 61
BAUER GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . C 201
VOGELSANG Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . C 200
TAD-LEN PPHU Światła Tadeusz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 102 . . . . . C 195
NDS-GRZEGORZ MICHAŁEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 . . . . . B 177
ŁUKOMET KRZYSZTOF ŁUSZCZYK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . C 202
ENDRESS-POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 . . . . . F 163
ZAKŁAD MECHANIKI MASZYN I URZĄDZEŃ ROLNICZYCH SŁAWOMIR BIARDZKI . . . . . . 114 . . . . . . C 59
0706 Rury, przewody i osprzęt/Pipes, hoses and accessories
AGRONOMIK POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . C 192
AGROMA Przesiębiorstwo Handlowe S.A. w Poznaniu . . . . . . . . . . . . . . . . . . . . 11 . . . . . A 171
AQUA-ROL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . . C 70
BAYWA AG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . C 199
BEZALIN S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 . . . . hala 25
BAUER GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . C 201
NDS-GRZEGORZ MICHAŁEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 . . . . . B 177
OTTO TH. MENKE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . . C 45
ŁUKOMET KRZYSZTOF ŁUSZCZYK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . C 202
0801 Technika zbioru ziarna/Grain harvesting technology
AGROTECHNIKA-BRUDZ WIESŁAW BRUDZ . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . . D 92
AGROMIX PUP Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 . . . . . A 263
TEHNOS d.o.o. Zalec . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104 . . . . . C 595
POLBOTO-AGRI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83 . . . . . . D 79
SOCIETE PROMODIS (SPÓŁKA AKCYJNA SPÓŁDZIELNIA) ODDZIAŁ W POLSCE . . . . . . . 98 . . . . . B 180
ROLMASZ-POL PRZEDSIĘBIORSTWO HANDLOWO-USŁUGOWE . . . . . . . . . . . . . . 92 . . . . . F 136
PRZEDSIĘBIORSTWO ROMANOWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . 88 . . . . . D 286
J.A. GĄSKA Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59 . . . . . F 132
EMMAROL SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 . . . . . E 118
OMARV SRL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 . . . . . E 446
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
CLAAS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . F 302
0802 Kombajny zbożowe/Combine harvesters
AGROTECHNIKA-BRUDZ WIESŁAW BRUDZ . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . . D 92
Branżowy spis wystawców
nr str.
stoisko
BARTESKO PRZEDSIĘBIORSTWO WIELOBRANŻOWE. Bartłomiej Skowroński . . . . . . . . 23 . . . . . . C 69
CASE IH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . D 284
SAME DEUTZ - FAHR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . 94 . . . . . C 275
ROLMASZ-POL PRZEDSIĘBIORSTWO HANDLOWO-USŁUGOWE . . . . . . . . . . . . . . 92 . . . . . F 136
PERKOZ PRZEDSIĘBIORSTWO HANDLOWO-USŁUGOWE Sp. z o.o. . . . . . . . . . . . . . 80 . . . . . B 184
LUPUS FIRMA HANDLOWA SYLWESTER WILK . . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . A 265
KORBANEK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65 . . . . . B 269
EMMAROL SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 . . . . . E 118
OMARV SRL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 . . . . . E 446
CLAAS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . F 302
0803 Kombajny - osprzęt i części/Combine harvesters - accessories and spare parts
AGROTECHNIKA-BRUDZ WIESŁAW BRUDZ . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . . D 92
AGROBERG Renata i Stanisław Berg S.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 . . . . . D 101
AGE-POWER Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 . . . . . E 117
AGRO-JAN S.c. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10 . . . . . . C 44
AGROGRUPA BOŻENA DRABEK SPÓŁKA KOMANDYTOWO-AKCYJNA . . . . . . . . . . . . 10 . . . . . F 154
CASE IH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . D 284
ZAKŁAD MECHANIZMÓW NAPĘDOWYCH S.C. Gabryjela Szydłowska Roman Tański . . . . 114 . . . . . F 140
SIMENA SPÓŁDZIELNIA Z.P.CH. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97 . . . . . F 135
SITONO WYTWÓRNIA SIT KRZYSZTOF NOWAKOWSKI . . . . . . . . . . . . . . . . . . . 97 . . . . . C 386
SITAMET WYTWÓRNIA SIT - NAPRAWA MASZYN CZYSZCZĄCYCH . . . . . . . . . . . . . 97 . . . . . D 430
ROLMASZ-POL PRZEDSIĘBIORSTWO HANDLOWO-USŁUGOWE . . . . . . . . . . . . . . 92 . . . . . F 136
ROLNICTWO PRECYZYJNE ANDRZEJ PRZEPERSKI . . . . . . . . . . . . . . . . . . . . . 92 . . . . . . D 96
MECHANIKA MASZYN I URZĄDZEŃ ROLNICZYCH TOMASZ PINKOWSKI . . . . . . . . . . . 72 . . . . . E 116
OTTO TH. MENKE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . . C 45
MESCOMP-OPRYSKIWACZE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74 . . . . . C 194
KOWALSCY PRODUKCJA MASZYN ROLNICZYCH I CZĘŚCI ZAMIENNYCH SPÓŁKA JAWNA . 65 . . . . . . . A 1
J.A. GĄSKA Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59 . . . . . F 132
HYDROTOR Przedsiębiorstwo Hydrauliki Siłowej S.A. . . . . . . . . . . . . . . . . . . . . 56 . . . . . F 160
INDUSTRIEHOF SCHERENBOSTEL HEINRICH RODENBOSTEL GmbH . . . . . . . . . . . . 56 . . . . . . C 46
FELIKS NAGLAK Przedsiębiorstwo Produkcyjno Usługowo Handlowe . . . . . . . . . . . . 43 . . . . . F 260
EMMAROL SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 . . . . . E 118
ENA LTD Sp z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 . . . . . C 597
CLAAS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . F 302
0804 Zespoły żniwne, zespoły tnące/Combine harvester heads, cutters
AGROTECHNIKA-BRUDZ WIESŁAW BRUDZ . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . . D 92
CASE IH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . D 284
ROLMETAL Przedsiębiorstwo Produkcyjno Handlowe . . . . . . . . . . . . . . . . . . . . 92 . . . . . A 172
ROLMASZ-POL PRZEDSIĘBIORSTWO HANDLOWO-USŁUGOWE . . . . . . . . . . . . . . 92 . . . . . F 136
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
MECHANIKA MASZYN I URZĄDZEŃ ROLNICZYCH TOMASZ PINKOWSKI . . . . . . . . . . .
J.A. GĄSKA Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . EMMAROL SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . OMARV SRL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 72 . . . . . E 116
59 . . . . . F 132
39 . . . . . 79 . . . . . ROLKAP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . CLAAS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . E 118
E 446
E 576
F 302
0805 Rozdrabniacze słomy/Choppers for combine harvesters
AGROTECHNIKA-BRUDZ WIESŁAW BRUDZ . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . . D 92
CASE IH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . D 284
ZUPTOR SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . D 412
TEHNOS d.o.o. Zalec . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104 . . . . . C 595
SIPMA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97 . . . . . C 212
SITONO WYTWÓRNIA SIT KRZYSZTOF NOWAKOWSKI . . . . . . . . . . . . . . . . . . . 97 . . . . . C 386
ROLMASZ-POL PRZEDSIĘBIORSTWO HANDLOWO-USŁUGOWE . . . . . . . . . . . . . . 92 . . . . . F 136
MAGROTEX Przedsiębiorstwo Produkcyjno Usługowe Sp. z o.o. . . . . . . . . . . . . . . . 70 . . . . . C 388
MECHANIKA MASZYN I URZĄDZEŃ ROLNICZYCH TOMASZ PINKOWSKI . . . . . . . . . . . 72 . . . . . E 116
KOWALSCY PRODUKCJA MASZYN ROLNICZYCH I CZĘŚCI ZAMIENNYCH SPÓŁKA JAWNA . 65 . . . . . . . A 1
EMMAROL SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 . . . . . E 118
DOZAMECH Mechanika Maszyn I Urządzeń Rolniczych Donat Zawidzki . . . . . . . . . . . 37 . . . . . C 403
OMARV SRL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 . . . . . E 446
0901 Technika zbioru zielonek/Forage harvesting technology
AGROMA Przesiębiorstwo Handlowe S.A. w Poznaniu . . . . . . . . . . . . . . . . . . . . 11 . . . . . A 171
AGROGRUPA BOŻENA DRABEK SPÓŁKA KOMANDYTOWO-AKCYJNA . . . . . . . . . . . . 10 . . . . . F 154
AGROMIX PUP Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 . . . . . A 263
UNIA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . C 278
PROGRASS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87 . . . . . . . A 3
POLBOTO-AGRI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83 . . . . . . D 79
SCHUITEMAKER MACHINES B.V. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . E 131
SOCIETE PROMODIS (SPÓŁKA AKCYJNA SPÓŁDZIELNIA) ODDZIAŁ W POLSCE . . . . . . . 98 . . . . . B 180
POL-STRAUTMANN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 85 . . . . . A 175
PRZEDSIĘBIORSTWO ROMANOWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . 88 . . . . . D 286
OTTO TH. MENKE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . . C 45
MASCAR SPA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . B 179
LUPUS FIRMA HANDLOWA SYLWESTER WILK . . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . A 265
OMARV SRL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 . . . . . E 446
TECH-KOM Przemysław Laskowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . F 305
ALOIS PÖTTINGER Maschinenfabrik GmbH . . . . . . . . . . . . . . . . . . . . . . . . . 16 . . . . . C 281
CLAAS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . F 302
JUNKKARI POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 294
Branżowy spis wystawców
nr str.
stoisko
0902 Kosiarki/Rotary and disc mowers
AGROTECHNIKA-BRUDZ WIESŁAW BRUDZ . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . . D 92
AGROTIMH Tomasz Iwaszkiewicz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 . . . . . D 215
ALTRO FPH JANUSZ WOŹNIAK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16 . . . . . . C 72
CELLI S.p.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . . B 28
ZAMET ZAKŁAD PRODUKCYJNO-USŁUGOWY Ryszard I Marcin Zabielscy Sp.j. . . . . . . 115 . . . . . . B 33
ZAKŁAD MECHANIZMÓW NAPĘDOWYCH S.C. Gabryjela Szydłowska Roman Tański . . . . 114 . . . . . F 140
ZETOR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . E 297
UNIROL PARTS SP. Z O.O. SP.K. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . . C 48
SAMASZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . D 292
TAD-LEN PPHU Światła Tadeusz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 102 . . . . . C 195
STALMECH Bogumił Księżakowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 . . . . . F 245
PROGRASS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87 . . . . . . . A 3
SIPMA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97 . . . . . C 212
STOMIL SANOK - DYSTRYBUCJA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . 101 . . . . . D 102
SAME DEUTZ - FAHR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . 94 . . . . . C 275
PREMIUM TRADE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . . B 38
MASCAR SPA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . B 179
KELLFRI SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 62 . . . . . E 235
KOWALSCY PRODUKCJA MASZYN ROLNICZYCH I CZĘŚCI ZAMIENNYCH SPÓŁKA JAWNA . 65 . . . . . . . A 1
JOSKIN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 289
DITTA SERIA Edmund Pietrzak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . D 216
ZAKŁAD MECHANIKI MASZYN I URZĄDZEŃ ROLNICZYCH SŁAWOMIR BIARDZKI . . . . . . 114 . . . . . . C 59
ALOIS PÖTTINGER Maschinenfabrik GmbH . . . . . . . . . . . . . . . . . . . . . . . . . 16 . . . . . C 281
JUNKKARI POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 294
0903 Spulchniacze i zgniatacze pokosów/Mower-conditioners
ZETOR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . E 297
SAMASZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . D 292
MASCAR SPA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . B 179
GENEU Beata Jerczyńska . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47 . . . . . F 491
EXPOM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41 . . . . . C 276
ALOIS PÖTTINGER Maschinenfabrik GmbH . . . . . . . . . . . . . . . . . . . . . . . . . 16 . . . . . C 281
0904 Przetrząsacze/Tedders
ZETOR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . E 297
UNIMETAL SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . D 419
SAMASZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . D 292
PROGRASS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87 . . . . . . . A 3
SAME DEUTZ - FAHR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . 94 . . . . . C 275
PROMAR - Zakład Produkcji Maszyn Rolniczych Dariusz Nowak . . . . . . . . . . . . . . . 87 . . . . . C 196
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
KELLFRI SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 62 . . . . . E 235
KOWALSCY PRODUKCJA MASZYN ROLNICZYCH I CZĘŚCI ZAMIENNYCH SPÓŁKA JAWNA . 65 . . . . . . . A 1
INVENTOR JOŃSKI JAN . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 58 . . . . . . A 16
ALOIS PÖTTINGER Maschinenfabrik GmbH . . . . . . . . . . . . . . . . . . . . . . . . . 16 . . . . . C 281
0905 Zgrabiarki/Windrowers
BAGRAMET SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . B 185
ZETOR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . E 297
UNIA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . C 278
UNIMETAL SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . D 419
SAMASZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . D 292
PROGRASS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87 . . . . . . . A 3
SIPMA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97 . . . . . C 212
SAME DEUTZ - FAHR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . 94 . . . . . C 275
PROMAR - Zakład Produkcji Maszyn Rolniczych Dariusz Nowak . . . . . . . . . . . . . . . 87 . . . . . C 196
PREMIUM TRADE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . . B 38
KELLFRI SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 62 . . . . . E 235
INVENTOR JOŃSKI JAN . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 58 . . . . . . A 16
JOSKIN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 289
ALOIS PÖTTINGER Maschinenfabrik GmbH . . . . . . . . . . . . . . . . . . . . . . . . . 16 . . . . . C 281
0906 Prasy zwijające/Round balers
AGROTECHNIKA-BRUDZ WIESŁAW BRUDZ . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . . D 92
CASE IH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . D 284
UNIA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . C 278
PROGRASS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87 . . . . . . . A 3
SIPMA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97 . . . . . C 212
SAME DEUTZ - FAHR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . 94 . . . . . C 275
MASCAR SPA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . B 179
KORBANEK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65 . . . . . B 269
KAGRO Krzysztof Pankowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . B 188
0907 Prasy wielkobelowe/Big balers
CASE IH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . D 284
SAME DEUTZ - FAHR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . 94 . . . . . C 275
0908 Sieczkarnie zbierające, ścinacze zielonkowe/Forage harvesters, mounted forage harvesters
STALMECH Bogumił Księżakowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 . . . . . F 245
KOWALSCY PRODUKCJA MASZYN ROLNICZYCH I CZĘŚCI ZAMIENNYCH SPÓŁKA JAWNA . 65 . . . . . . . A 1
OMARV SRL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 . . . . . E 446
JUNKKARI POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 294
Branżowy spis wystawców
nr str.
stoisko
0909 Przyczepy zbierające/Self-loading trailers
AGROTECHNIKA-BRUDZ WIESŁAW BRUDZ . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . . D 92
ZAMET ZAKŁAD PRODUKCYJNO-USŁUGOWY Ryszard I Marcin Zabielscy Sp.j. . . . . . . 115 . . . . . . B 33
STALMECH Bogumił Księżakowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 . . . . . F 245
SCHUITEMAKER MACHINES B.V. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . E 131
POL-STRAUTMANN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 85 . . . . . A 175
LUDWIG BERGMANN GmbH Maschinenfabrik . . . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . F 258
KOBZARENKO Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 63 . . . . . F 250
ALOIS PÖTTINGER Maschinenfabrik GmbH . . . . . . . . . . . . . . . . . . . . . . . . . 16 . . . . . C 281
0910 Owijarki bel/Bale wrappers
ALTRO FPH JANUSZ WOŹNIAK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16 . . . . . . C 72
UNIA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . C 278
SAMASZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . D 292
ROLMAKO P.H.U.T.P. HENRYK KOWALSKI . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . A 176
PROGRASS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87 . . . . . . . A 3
SIPMA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97 . . . . . C 212
PREMIUM TRADE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . . B 38
MASCAR SPA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . B 179
JFC POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59 . . . . . F 477
GAMA P.H.U. SZEPIETOWSCY SP.J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47 . . . . . F 483
0911 Prasoowijarki/Baler/wrapper combinations
CASE IH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . D 284
MASCAR SPA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . B 179
0912 Urządzenia do napełniania silosów/Distribution equipment for bunker silos
BAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . D 422
DENIS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . E 298
MAGROTEX Przedsiębiorstwo Produkcyjno Usługowe Sp. z o.o. . . . . . . . . . . . . . . . 70 . . . . . C 388
MICHALAK PRZEDSIĘBIORSTWO PRODUKCYJNO-HANDLOWO-USŁUGOWE . . . . . . . . 75 . . . . . . A 10
RICHIGER (LANDTECHNIK GUT RENZOW GMBH) . . . . . . . . . . . . . . . . . . . . . . 90 . . . . . . B 32
0913 Technika wybierania kiszonki z silosów/Silage unloading equipment for bunker silos
AGROTECHNIKA-BRUDZ WIESŁAW BRUDZ . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . . D 92
DENIS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . E 298
POL-STRAUTMANN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 85 . . . . . A 175
METALINVEST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74 . . . . . C 206
JFC POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59 . . . . . F 477
DOBROWOLSKI MASZYNY ROLNICZE RADOSŁAW DOBROWOLSKI . . . . . . . . . . . . . 36 . . . . . . C 71
DOZAMECH Mechanika Maszyn I Urządzeń Rolniczych Donat Zawidzki . . . . . . . . . . . 37 . . . . . C 403
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
1001 Technika zbioru okopowych/Root crop harvesting technology
AGROMA Przesiębiorstwo Handlowe S.A. w Poznaniu . . . . . . . . . . . . . . . . . . . . 11 . . . . . A 171
APH GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . C 524
UNIA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . C 278
SOCIETE PROMODIS (SPÓŁKA AKCYJNA SPÓŁDZIELNIA) ODDZIAŁ W POLSCE . . . . . . . 98 . . . . . B 180
PRZEDSIĘBIORSTWO ROMANOWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . 88 . . . . . D 286
OTTO TH. MENKE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . . C 45
KUJAWSKA FABRYKA MASZYN ROLNICZYCH Sp. z o.o. . . . . . . . . . . . . . . . . . . . 67 . . . . . C 203
GRIMME LANDMASCHINENFABRIK GmbH & Co.KG . . . . . . . . . . . . . . . . . . . . 49 . . . . . C 279
GUMSTAL Stanisława Lubiszewska . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51 . . . . . C 515
1002 Kopaczki do ziemniaków/Potarto diggers
APH GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . C 524
ALTRO FPH JANUSZ WOŹNIAK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16 . . . . . . C 72
TEHNOS d.o.o. Zalec . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104 . . . . . C 595
MECHANIKA MASZYN I URZĄDZEŃ ROLNICZYCH TOMASZ PINKOWSKI . . . . . . . . . . . 72 . . . . . E 116
KUJAWSKA FABRYKA MASZYN ROLNICZYCH Sp. z o.o. . . . . . . . . . . . . . . . . . . . 67 . . . . . C 203
GRIMME LANDMASCHINENFABRIK GmbH & Co.KG . . . . . . . . . . . . . . . . . . . . 49 . . . . . C 279
GUMSTAL Stanisława Lubiszewska . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51 . . . . . C 515
1003 Kombajny do zbioru ziemniaków/Potato harvesters
MECHANIKA MASZYN I URZĄDZEŃ ROLNICZYCH TOMASZ PINKOWSKI . . . . . . . . . . .
KUJAWSKA FABRYKA MASZYN ROLNICZYCH Sp. z o.o. . . . . . . . . . . . . . . . . . . .
GEO Di BOERI GIOVANNA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
GRIMME LANDMASCHINENFABRIK GmbH & Co.KG . . . . . . . . . . . . . . . . . . . . GUMSTAL Stanisława Lubiszewska . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 72 . . . . . E 116
67 . . . . . C 203
47 . . . . . . . A 2
49 . . . . . C 279
51 . . . . . C 515
1004 Kombajny do zbioru buraków cukrowych/Sugar beet harvesting techniques
AGRIFAC MACHINERY B.V. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 . . . . . E 299
GRIMME LANDMASCHINENFABRIK GmbH & Co.KG . . . . . . . . . . . . . . . . . . . . 49 . . . . . C 279
GUMSTAL Stanisława Lubiszewska . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51 . . . . . C 515
1005 Czyszczarko-ładowarki do buraków/Sugar beet cleaning loaders
GUMSTAL Stanisława Lubiszewska . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51 . . . . . C 515
1101 Technika pozbiorowej obróbki plonów, konserwacji i przechowywania
/Conditioning, handling, conservation and storage of harvest products
AMAN JANUSZ MŁYNARCZYK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGROMA Przesiębiorstwo Handlowe S.A. w Poznaniu . . . . . . . . . . . . . . . . . . . .
APH GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BÜHLER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BUSCHHOFF TH. GmbH & Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . C 509
11 . . . . . A 171
18 . . . . . C 524
28 . . . . . C 401
29 . . . . . C 404
Branżowy spis wystawców
nr str.
stoisko
BAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . D 422
ZUPTOR SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . D 412
DENIS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . E 298
RESTAL ZAKŁAD WYROBÓW METALOWYCH ELŻBIETA REMBIASZ . . . . . . . . . . . . . 90 . . . . . D 413
SITONO WYTWÓRNIA SIT KRZYSZTOF NOWAKOWSKI . . . . . . . . . . . . . . . . . . . 97 . . . . . C 386
PRO-VEGA Sp.j. M. WRÓBLEWSKI, M. ŁUKASIEWICZ . . . . . . . . . . . . . . . . . . . . 88 . . . . . C 527
PAT Chomutow SP.J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 . . . . . D 425
MAGROTEX Przedsiębiorstwo Produkcyjno Usługowe Sp. z o.o. . . . . . . . . . . . . . . . 70 . . . . . C 388
RICHIGER (LANDTECHNIK GUT RENZOW GMBH) . . . . . . . . . . . . . . . . . . . . . . 90 . . . . . . B 32
KLIMTOP CONTROLS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . 63 . . . . . C 503
KAROL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . D 427
GUMSTAL Stanisława Lubiszewska . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51 . . . . . C 515
FEERUM S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 43 . . . . . C 410
BZK Group Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . E 580
1102 Hale, magazyny, przechowalnie/Shed construction, multi-purpose sheds
ADNAR KOŁODZIEJCZYK DANIEL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 . . . . . C 405
ALICJA ZAKŁAD HANDLOWO-PRODUKCYJNO-USŁUGOWY HENRYK GĘBAŁA . . . . . . . 16 . . . . . C 532
BIN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 . . . . . C 394
BORGA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . hala 23
STALMACH MACHOWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 . . . . . D 545
STILL POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101 . . . . . C 534
STAL IMPEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 . . . . . D 542
RICHEL SERRES DE FRANCE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 90 . . . . . D 551
ROLSTAL Pawłowski Pawłowski Janusz . . . . . . . . . . . . . . . . . . . . . . . . . . . 92 . . . . . F 456
RIELA POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . D 290
PAT Chomutow SP.J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 . . . . . D 425
ZAKŁAD MECHANICZNY PROGRESS Leszek Sawicki . . . . . . . . . . . . . . . . . . . . 114 . . . . . D 550
ORLEN GAZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 . . . . . C 385
LOGIS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . C 517
KLIMTOP CONTROLS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . 63 . . . . . C 503
KINGSPAN INSULATION Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 62 . . . . . E 447
KOBEX HALE I WIATY STALOWE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 63 . . . . . D 538
HUPRO, spol. S.r.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . D 549
FRISOMAT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 46 . . . . . C 533
FEERUM S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 43 . . . . . C 410
RO.SA-HALE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . hala 15
TRAMP J.J. Mikusz Sp. J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 106 . . . . . E 591
1103 Materiały budowlane/Building materials
AMAN JANUSZ MŁYNARCZYK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . C 509
BORGA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . hala 23
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
CEMBRIT S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . D 420
STALMACH MACHOWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 . . . . . D 545
KINGSPAN INSULATION Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 62 . . . . . E 447
RO.SA-HALE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . hala 15
1104 Zbiorniki i silosy/Containers, silos and accessories
ADNAR KOŁODZIEJCZYK DANIEL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 . . . . . C 405
AGREMO Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 . . . . . C 391
BUTTIMER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . C 387
BÜHLER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28 . . . . . C 401
BIN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 . . . . . C 394
BUSCHHOFF TH. GmbH & Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . C 404
ZUPTOR SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . D 412
DENIS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . E 298
TORNUM POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . C 407
RESTAL ZAKŁAD WYROBÓW METALOWYCH ELŻBIETA REMBIASZ . . . . . . . . . . . . . 90 . . . . . D 413
SILOTECH KOMOROWSKI SPÓŁKA JAWNA . . . . . . . . . . . . . . . . . . . . . . . . . 97 . . . . . D 426
SITONO WYTWÓRNIA SIT KRZYSZTOF NOWAKOWSKI . . . . . . . . . . . . . . . . . . . 97 . . . . . C 386
RICHEL SERRES DE FRANCE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 90 . . . . . D 551
RIELA POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . D 290
POM KALISZ PPHiU Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 85 . . . . . C 409
PAT Chomutow SP.J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 . . . . . D 425
MAGROTEX Przedsiębiorstwo Produkcyjno Usługowe Sp. z o.o. . . . . . . . . . . . . . . . 70 . . . . . C 388
M-ROL SPÓŁKA Z OGRANICZONĄ ODPOWIEDZIALNOŚCIĄ SP.K. . . . . . . . . . . . . . . 76 . . . . . C 390
RICHIGER (LANDTECHNIK GUT RENZOW GMBH) . . . . . . . . . . . . . . . . . . . . . . 90 . . . . . . B 32
KONSIL PRZEDSIĘBIORSTWO OBSŁUGI ROLNICTWA . . . . . . . . . . . . . . . . . . . 64 . . . . . C 395
GXL POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52 . . . . . . D 85
FEERUM S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 43 . . . . . C 410
AGROSIL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . C 389
DITTA SERIA Edmund Pietrzak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . D 216
AGRO MET Z.P.H.U. S.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . D 424
1105 Suszarnie do zielonek/Drying installations for forage plants
BÜHLER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28 . . . . . C 401
SITONO WYTWÓRNIA SIT KRZYSZTOF NOWAKOWSKI . . . . . . . . . . . . . . . . . . . 97 . . . . . C 386
1106 Zaprawiarki/Seed dressing equipment, seed dressing installations
BUTTIMER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . C 387
ZUPTOR SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . D 412
DENIS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . E 298
RIELA POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . D 290
Branżowy spis wystawców
nr str.
stoisko
MADOKS Dariusz Przegaliński . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70 . . . . . C 529
SERAFIN P.U.H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . D 294
1107 Technika pozbiorowej obróbki ziarna/Storage installations for grain
BUTTIMER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . C 387
BÜHLER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28 . . . . . C 401
BIN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 . . . . . C 394
BUSCHHOFF TH. GmbH & Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . C 404
ZUPTOR SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . D 412
DENIS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . E 298
SALIDA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . C 402
RESTAL ZAKŁAD WYROBÓW METALOWYCH ELŻBIETA REMBIASZ . . . . . . . . . . . . . 90 . . . . . D 413
SIPMA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97 . . . . . C 212
RIELA POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . D 290
PAT Chomutow SP.J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 . . . . . D 425
MADOKS Dariusz Przegaliński . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70 . . . . . C 529
RICHIGER (LANDTECHNIK GUT RENZOW GMBH) . . . . . . . . . . . . . . . . . . . . . . 90 . . . . . . B 32
FEERUM S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 43 . . . . . C 410
DAF AGRO - ANDO TECH Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . E 600
BZK Group Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . E 580
1108 Przenośniki do transportu ziarna/Conveying equipment for grain
ADNAR KOŁODZIEJCZYK DANIEL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 . . . . . C 405
AGREMO Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 . . . . . C 391
BUTTIMER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . C 387
BÜHLER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28 . . . . . C 401
BIN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 . . . . . C 394
BUSCHHOFF TH. GmbH & Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . C 404
ZUPTOR SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . D 412
DENIS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . E 298
TORNUM POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . C 407
RESTAL ZAKŁAD WYROBÓW METALOWYCH ELŻBIETA REMBIASZ . . . . . . . . . . . . . 90 . . . . . D 413
STOMIL SANOK - DYSTRYBUCJA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . 101 . . . . . D 102
SITAMET WYTWÓRNIA SIT - NAPRAWA MASZYN CZYSZCZĄCYCH . . . . . . . . . . . . . 97 . . . . . D 430
ROLMET Zakład Wytwórczo-Usługowy s.c. . . . . . . . . . . . . . . . . . . . . . . . . . 92 . . . . . C 392
RIELA POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . D 290
POM KALISZ PPHiU Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 85 . . . . . C 409
PRACOWNICZY OŚRODEK MASZYNOWY W AUGUSTOWIE Sp. z o.o. . . . . . . . . . . . . 86 . . . . . C 276
MADOKS Dariusz Przegaliński . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70 . . . . . C 529
MAGROTEX Przedsiębiorstwo Produkcyjno Usługowe Sp. z o.o. . . . . . . . . . . . . . . . 70 . . . . . C 388
MICHALAK PRZEDSIĘBIORSTWO PRODUKCYJNO-HANDLOWO-USŁUGOWE . . . . . . . . 75 . . . . . . A 10
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
RICHIGER (LANDTECHNIK GUT RENZOW GMBH) . . . . . . . . . . . . . . . . . . . . . . 90 . . . . . . B 32
KOBZARENKO Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 63 . . . . . F 250
KAROL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . D 427
GXL POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52 . . . . . . D 85
GRIMME LANDMASCHINENFABRIK GmbH & Co.KG . . . . . . . . . . . . . . . . . . . . 49 . . . . . C 279
FEERUM S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 43 . . . . . C 410
AGROSIL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . C 389
DOZAMECH Mechanika Maszyn I Urządzeń Rolniczych Donat Zawidzki . . . . . . . . . . . 37 . . . . . C 403
DAF AGRO - ANDO TECH Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . E 600
1109 Suszarnie do ziarna/Drying installations for grain
AGROUNIMA PRZEDSIĘBIORSTWO WIELOFUNKCYJNE mgr inż.. Cezary Sztuder . . . . . . 14 . . . . . D 429
ADNAR KOŁODZIEJCZYK DANIEL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 . . . . . C 405
AGREMO Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 . . . . . C 391
BUTTIMER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . C 387
BÜHLER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28 . . . . . C 401
BUSCHHOFF TH. GmbH & Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . C 404
ZUPTOR SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . D 412
DRZEWICZ Wytwórnia Suszarń K. Rokicki . . . . . . . . . . . . . . . . . . . . . . . . . . 37 . . . . . D 415
TORNUM POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . C 407
SALIDA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . C 402
SITONO WYTWÓRNIA SIT KRZYSZTOF NOWAKOWSKI . . . . . . . . . . . . . . . . . . . 97 . . . . . C 386
SITAMET WYTWÓRNIA SIT - NAPRAWA MASZYN CZYSZCZĄCYCH . . . . . . . . . . . . . 97 . . . . . D 430
RIELA POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . D 290
PEDROTTI POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 . . . . . D 417
PAT Chomutow SP.J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 . . . . . D 425
ORLEN GAZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 . . . . . C 385
MEC-POL SUSZARNIE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 72 . . . . . D 416
M-ROL SPÓŁKA Z OGRANICZONĄ ODPOWIEDZIALNOŚCIĄ SP.K. . . . . . . . . . . . . . . 76 . . . . . C 390
SERAFIN P.U.H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . D 294
FEERUM S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 43 . . . . . C 410
DOZAMECH Mechanika Maszyn I Urządzeń Rolniczych Donat Zawidzki . . . . . . . . . . . 37 . . . . . C 403
1110 Młyny do ziarna/Mills and accessories (cereal, maize)
BÜHLER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28 . . . . . C 401
BARBATUS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . D 418
BUSCHHOFF TH. GmbH & Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . C 404
BAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . D 422
ZUPTOR SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . D 412
DENIS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . E 298
UNIMETAL SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . D 419
Branżowy spis wystawców
nr str.
stoisko
SITONO WYTWÓRNIA SIT KRZYSZTOF NOWAKOWSKI . . . . . . . . . . . . . . . . . . . 97 . . . . . C 386
SITAMET WYTWÓRNIA SIT - NAPRAWA MASZYN CZYSZCZĄCYCH . . . . . . . . . . . . . 97 . . . . . D 430
RIELA POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . D 290
MADOKS Dariusz Przegaliński . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70 . . . . . C 529
MAGROTEX Przedsiębiorstwo Produkcyjno Usługowe Sp. z o.o. . . . . . . . . . . . . . . . 70 . . . . . C 388
M-ROL SPÓŁKA Z OGRANICZONĄ ODPOWIEDZIALNOŚCIĄ SP.K. . . . . . . . . . . . . . . 76 . . . . . C 390
RICHIGER (LANDTECHNIK GUT RENZOW GMBH) . . . . . . . . . . . . . . . . . . . . . . 90 . . . . . . B 32
GXL POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52 . . . . . . D 85
DOZAMECH Mechanika Maszyn I Urządzeń Rolniczych Donat Zawidzki . . . . . . . . . . . 37 . . . . . C 403
DAF AGRO - ANDO TECH Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . E 600
1111 Technika pozbiorowej obróbki ziemniaków/Conveying and grading equipment for potatoes
APH GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . C 524
REMPRODEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 90 . . . . . F 253
PRO-VEGA Sp.j. M. WRÓBLEWSKI, M. ŁUKASIEWICZ . . . . . . . . . . . . . . . . . . . . 88 . . . . . C 527
FIRMA PRODUKCYJNO USŁUGOWO HANDLOWA MICHAŁ MICHALAK . . . . . . . . . . . 43 . . . . . . B 31
KLIMTOP CONTROLS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . 63 . . . . . C 503
GUMSTAL Stanisława Lubiszewska . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51 . . . . . C 515
1112 Wyposażenie przechowalni ziemniaków/Installations for storage and processing of potatoes
AMAN JANUSZ MŁYNARCZYK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . C 509
APH GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . C 524
REMPRODEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 90 . . . . . F 253
PRO-VEGA Sp.j. M. WRÓBLEWSKI, M. ŁUKASIEWICZ . . . . . . . . . . . . . . . . . . . . 88 . . . . . C 527
FIRMA PRODUKCYJNO USŁUGOWO HANDLOWA MICHAŁ MICHALAK . . . . . . . . . . . 43 . . . . . . B 31
KLIMTOP CONTROLS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . 63 . . . . . C 503
GRIMME LANDMASCHINENFABRIK GmbH & Co.KG . . . . . . . . . . . . . . . . . . . . 49 . . . . . C 279
1113 Wentylacja i klimatyzacja/Storage facilities - air conditioning technology
BÜHLER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28 . . . . . C 401
BARTESKO PRZEDSIĘBIORSTWO WIELOBRANŻOWE. Bartłomiej Skowroński . . . . . . . . 23 . . . . . . C 69
RESTAL ZAKŁAD WYROBÓW METALOWYCH ELŻBIETA REMBIASZ . . . . . . . . . . . . . 90 . . . . . D 413
RIELA POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . D 290
KLIMTOP CONTROLS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . 63 . . . . . C 503
KAROL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . D 427
FEERUM S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 43 . . . . . C 410
ENA LTD Sp z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 . . . . . C 597
TYWENT Sp. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . E 586
1201 Maszyny warzywnicze i sadownicze/Machinery for horticulture and orcharding
AGROMA Przesiębiorstwo Handlowe S.A. w Poznaniu . . . . . . . . . . . . . . . . . . . . 11 . . . . . A 171
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
ARIKON-AGRO Przedsiębiorstwo Wielobranżowe . . . . . . . . . . . . . . . . . . . . . . 19 . . . . . C 516
AGROTIMH Tomasz Iwaszkiewicz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 . . . . . D 215
APH GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . C 524
CELLI S.p.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . . B 28
WEREMCZUK FMR Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . C 526
SOLAN T.CZECH, Ł.CZECH Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98 . . . . . C 521
SOCIETE PROMODIS (SPÓŁKA AKCYJNA SPÓŁDZIELNIA) ODDZIAŁ W POLSCE . . . . . . . 98 . . . . . B 180
PRZEDSIĘBIORSTWO ROMANOWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . 88 . . . . . D 286
PREMIUM TRADE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . . B 38
PRO-VEGA Sp.j. M. WRÓBLEWSKI, M. ŁUKASIEWICZ . . . . . . . . . . . . . . . . . . . . 88 . . . . . C 527
NAJBAR F. H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 . . . . . F 252
KRUSZEC ZAKŁAD USŁUGOWO-PRODUKCYJNY . . . . . . . . . . . . . . . . . . . . . . 66 . . . . . C 519
GRIMME LANDMASCHINENFABRIK GmbH & Co.KG . . . . . . . . . . . . . . . . . . . . 49 . . . . . C 279
DITTA SERIA Edmund Pietrzak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . D 216
ROLKAP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . E 576
1202 Ciągniki jednoosiowe i specjalne/Two-wheeled tractors and special tractors
CMKS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . C 210
PREMIUM TRADE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . . B 38
SERAFIN P.U.H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . D 294
HORTMASZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . E 231
1203 Osprzęt ciągników jednoosiowych i specjalnych
/Machinery and equipment for two-wheeled tractors and special tractors
CMKS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . HYDROPRESS HYDRAULIKA SIŁOWA . . . . . . . . . . . . . . . . . . . . . . . . . . . .
HORTMASZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ENA LTD Sp z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
32 . . . . . C 210
56 . . . . . F 161
55 . . . . . E 231
39 . . . . . C 597
1204 Siewniki warzywnicze/Seeders
WEREMCZUK FMR Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . C 526
PREMIUM TRADE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . . B 38
NDS-GRZEGORZ MICHAŁEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 . . . . . B 177
NAJBAR F. H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 . . . . . F 252
KRUSZEC ZAKŁAD USŁUGOWO-PRODUKCYJNY . . . . . . . . . . . . . . . . . . . . . . 66 . . . . . C 519
ŁUCZAK MASZYNY ROLNICZE Stanisław Łuczak . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . F 240
1205 Sadzarki do rozsady/Planters
AGROTIMH Tomasz Iwaszkiewicz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 . . . . . D 215
WEREMCZUK FMR Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . C 526
SOLAN T.CZECH, Ł.CZECH Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98 . . . . . C 521
Branżowy spis wystawców
nr str.
stoisko
NDS-GRZEGORZ MICHAŁEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 . . . . . B 177
NAJBAR F. H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 . . . . . F 252
KUJAWSKA FABRYKA MASZYN ROLNICZYCH Sp. z o.o. . . . . . . . . . . . . . . . . . . . 67 . . . . . C 203
KRUSZEC ZAKŁAD USŁUGOWO-PRODUKCYJNY . . . . . . . . . . . . . . . . . . . . . . 66 . . . . . C 519
ŁUCZAK MASZYNY ROLNICZE Stanisław Łuczak . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . F 240
1206 Maszyny do formowania redlin/Ridge tillers
APH GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . C 524
WEREMCZUK FMR Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . C 526
NDS-GRZEGORZ MICHAŁEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 . . . . . B 177
NAJBAR F. H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 . . . . . F 252
KRUSZEC ZAKŁAD USŁUGOWO-PRODUKCYJNY . . . . . . . . . . . . . . . . . . . . . . 66 . . . . . C 519
GRIMME LANDMASCHINENFABRIK GmbH & Co.KG . . . . . . . . . . . . . . . . . . . . 49 . . . . . C 279
1207 Frezarki międzyrzędowe/Row tillers
CENTRUM TECHNIKI ROLNICZEJ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 31 . . . . . C 507
KRUSZEC ZAKŁAD USŁUGOWO-PRODUKCYJNY . . . . . . . . . . . . . . . . . . . . . . 66 . . . . . C 519
ŁUCZAK MASZYNY ROLNICZE Stanisław Łuczak . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . F 240
GRIMME LANDMASCHINENFABRIK GmbH & Co.KG . . . . . . . . . . . . . . . . . . . . 49 . . . . . C 279
1208 Technika nawadniania kropelkowego/Drip irrigation
POLBOTO-AGRI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83 . . . . . . D 79
1209 Kombajny do zbioru warzyw/Vegetable harvesters
APH GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . C 524
WEREMCZUK FMR Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . C 526
NAJBAR F. H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 . . . . . F 252
GRIMME LANDMASCHINENFABRIK GmbH & Co.KG . . . . . . . . . . . . . . . . . . . . 49 . . . . . C 279
GUMSTAL Stanisława Lubiszewska . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51 . . . . . C 515
1210 Maszyny do zbioru owoców/Machinery for fruit growing
WEREMCZUK FMR Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . C 526
DITTA SERIA Edmund Pietrzak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . D 216
1211 Sortowniki/Sorting technology
APH GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
REMPRODEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . PRO-VEGA Sp.j. M. WRÓBLEWSKI, M. ŁUKASIEWICZ . . . . . . . . . . . . . . . . . . . .
PAT Chomutow SP.J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . NAJBAR F. H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . FIRMA PRODUKCYJNO USŁUGOWO HANDLOWA MICHAŁ MICHALAK . . . . . . . . . . . 18 . . . . . C 524
90 . . . . . F 253
88 . . . . . C 527
80 . . . . . D 425
77 . . . . . F 252
43 . . . . . . B 31
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
KUJAWSKA FABRYKA MASZYN ROLNICZYCH Sp. z o.o. . . . . . . . . . . . . . . . . . . . 67 . . . . . C 203
ŁUCZAK MASZYNY ROLNICZE Stanisław Łuczak . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . F 240
GRIMME LANDMASCHINENFABRIK GmbH & Co.KG . . . . . . . . . . . . . . . . . . . . 49 . . . . . C 279
GUMSTAL Stanisława Lubiszewska . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51 . . . . . C 515
JUNKKARI POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 294
1212 Przenośniki/Conveying equipment
APH GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
RESTAL ZAKŁAD WYROBÓW METALOWYCH ELŻBIETA REMBIASZ . . . . . . . . . . . . . REMPRODEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . PRO-VEGA Sp.j. M. WRÓBLEWSKI, M. ŁUKASIEWICZ . . . . . . . . . . . . . . . . . . . .
NAJBAR F. H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . FIRMA PRODUKCYJNO USŁUGOWO HANDLOWA MICHAŁ MICHALAK . . . . . . . . . . . ŁUCZAK MASZYNY ROLNICZE Stanisław Łuczak . . . . . . . . . . . . . . . . . . . . . . GRIMME LANDMASCHINENFABRIK GmbH & Co.KG . . . . . . . . . . . . . . . . . . . . GUMSTAL Stanisława Lubiszewska . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . C 524
90 . . . . . D 413
90 . . . . . F 253
88 . . . . . C 527
77 . . . . . F 252
43 . . . . . . B 31
69 . . . . . F 240
49 . . . . . C 279
51 . . . . . C 515
1213 Pojemniki/Big boxes
APH GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . C 524
PARTNER SYSTEMS SPÓŁKA Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 . . . . . . D 86
METALINVEST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74 . . . . . C 206
KLIMTOP CONTROLS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . 63 . . . . . C 503
1214 Wagoworkownice/Weighing technology
ARIKON-AGRO Przedsiębiorstwo Wielobranżowe . . . . . . . . . . . . . . . . . . . . . . APH GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
REMPRODEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . PRO-VEGA Sp.j. M. WRÓBLEWSKI, M. ŁUKASIEWICZ . . . . . . . . . . . . . . . . . . . .
NAJBAR F. H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . FIRMA PRODUKCYJNO USŁUGOWO HANDLOWA MICHAŁ MICHALAK . . . . . . . . . . . ŁUCZAK MASZYNY ROLNICZE Stanisław Łuczak . . . . . . . . . . . . . . . . . . . . . . GRIMME LANDMASCHINENFABRIK GmbH & Co.KG . . . . . . . . . . . . . . . . . . . . 19 . . . . . C 516
18 . . . . . C 524
90 . . . . . F 253
88 . . . . . C 527
77 . . . . . F 252
43 . . . . . . B 31
69 . . . . . F 240
49 . . . . . C 279
1215 Technika pakowania warzyw/Packing and marketing installations for vegetables
APH GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PRO-VEGA Sp.j. M. WRÓBLEWSKI, M. ŁUKASIEWICZ . . . . . . . . . . . . . . . . . . . .
NAJBAR F. H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . FIRMA PRODUKCYJNO USŁUGOWO HANDLOWA MICHAŁ MICHALAK . . . . . . . . . . . KLIMTOP CONTROLS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . GRIMME LANDMASCHINENFABRIK GmbH & Co.KG . . . . . . . . . . . . . . . . . . . . 18 . . . . . C 524
88 . . . . . C 527
77 . . . . . F 252
43 . . . . . . B 31
63 . . . . . C 503
49 . . . . . C 279
Branżowy spis wystawców
nr str.
stoisko
1216 Wyposażenie przechowalni warzyw i owoców
/Storage and processing installations for vegetables and fruit
ARIKON-AGRO Przedsiębiorstwo Wielobranżowe . . . . . . . . . . . . . . . . . . . . . . 19 . . . . . C 516
APH GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . C 524
TOOLMEX TRUCK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . C 375
PRO-VEGA Sp.j. M. WRÓBLEWSKI, M. ŁUKASIEWICZ . . . . . . . . . . . . . . . . . . . . 88 . . . . . C 527
KLIMTOP CONTROLS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . 63 . . . . . C 503
GRIMME LANDMASCHINENFABRIK GmbH & Co.KG . . . . . . . . . . . . . . . . . . . . 49 . . . . . C 279
1217 Folia, siatka, agrowłóknina/Sheeting material, nonwovens, netting
BEZALIN S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . BAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . CENTER PLAST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
NAJBAR F. H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . MARMA POLSKIE FOLIE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . DUO PLAST AG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
24 . . . . hala 25
22 . . . . . D 422
31 . B B362, C508
77 . . . . . F 252
71 . . . . . C 511
37 . . . . . D 563
1301 Maszyny i urządzenia dla rolnictwa ekologicznego/Machines and equipment for ecological farming
APV POLSKA DANUTA MŁOCEK-BIEŻUŃSKA . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . . B 37
TOOLMEX TRUCK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . C 375
SOLAN T.CZECH, Ł.CZECH Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98 . . . . . C 521
STAL IMPEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 . . . . . D 542
PAT Chomutow SP.J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 . . . . . D 425
MADOKS Dariusz Przegaliński . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70 . . . . . C 529
ORLEN GAZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 . . . . . C 385
PRECYZYJNEROLNICTWO.COM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . D 109
LEMKEN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . F 308
ŁUCZAK MASZYNY ROLNICZE Stanisław Łuczak . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . F 240
ŁUKOMET KRZYSZTOF ŁUSZCZYK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . C 202
1401 Mechanizacja produkcji zwierzęcej/Technical products and equipment for livestock farming
AGROMA Przesiębiorstwo Handlowe S.A. w Poznaniu . . . . . . . . . . . . . . . . . . . . 11 . . . . . A 171
AGROMIX PUP Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 . . . . . A 263
ACO FUNKI AS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 . . . . . E 450
ASAT INTERNATIONAL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20 . . . . . E 448
PRZEDSIĘBIORSTWO WIELOBRANŻOWE BORYS S.C. . . . . . . . . . . . . . . . . . . . . 88 . . . . . D 421
BIN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 . . . . . C 394
ZAKŁADY METALOWE W PRZYSIEKACH SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . 115 . . . . . F 466
DENIS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . E 298
WOLF SYSTEM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 112 . . . . . D 537
ROLAND FIRMA PRODUKCJA HANDEL USŁUGI Ryszard Drąg . . . . . . . . . . . . . . . . 91 . . . . . F 488
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
R.J.-ROLIMPEX Przedsiębiorstwo Produkcyjno-Handlowe . . . . . . . . . . . . . . . . . . 89 . . . . . F 486
ROLSTAL Pawłowski Pawłowski Janusz . . . . . . . . . . . . . . . . . . . . . . . . . . . 92 . . . . . F 456
RIELA POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . D 290
PELLON SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 . . . . . F 484
POL-STRAUTMANN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 85 . . . . . A 175
POLNET Sp. z o.o. I WSPÓLNICY SPÓŁKA KOMANDYTOWA . . . . . . . . . . . . . . . . 84 . . . . . E 441
LUCAS.G . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . . B 27
INWEST-AGRO TECHNICZNA OBSŁUGA ROLNICTWA WOJCIECH SIEŃKO . . . . . . . . . . 58 . . . . . F 470
JFC POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59 . . . . . F 477
HOG SLAT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54 . . . . . E 439
HODOWCA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54 . . . . . F 487
GXL POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52 . . . . . . D 85
GENEU Beata Jerczyńska . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47 . . . . . F 491
FERMO KAROL OWCZAREK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 43 . . . . . D 432
DAF AGRO - ANDO TECH Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . E 600
AGROCOMPLEX . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . D 547
V.V.M TECHTRADE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . E 436
1402 Wyposażenie chlewni/Piggery equipment and instalations
AGROUNIMA PRZEDSIĘBIORSTWO WIELOFUNKCYJNE mgr inż.. Cezary Sztuder . . . . . . 14 . . . . . D 429
AGROMET PRODUKCJA MASZYN ROLNICZYCH TOMASZ ST. MATELSKI . . . . . . . . . . 12 . . . . . . . A 5
AGROGRUPA BOŻENA DRABEK SPÓŁKA KOMANDYTOWO-AKCYJNA . . . . . . . . . . . . 10 . . . . . F 154
ACO FUNKI AS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 . . . . . E 450
ASAT INTERNATIONAL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20 . . . . . E 448
BIG DUTCHMAN SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 . . . . . E 434
BIN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 . . . . . C 394
BAUER GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . C 201
VOGELSANG Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . C 200
WOLF SYSTEM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 112 . . . . . D 537
ROLAND FIRMA PRODUKCJA HANDEL USŁUGI Ryszard Drąg . . . . . . . . . . . . . . . . 91 . . . . . F 488
THYE LOKENBERG-POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . E 433
TERRAEXIM-AGROIMPEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104 . . . . . E 436
SILOTECH KOMOROWSKI SPÓŁKA JAWNA . . . . . . . . . . . . . . . . . . . . . . . . . 97 . . . . . D 426
SPÓŁDZIELNIA INWESTYCJI I BUDOWNICTWA W ŁOWICZU . . . . . . . . . . . . . . . . . 99 . . . . . F 465
R.J.-ROLIMPEX Przedsiębiorstwo Produkcyjno-Handlowe . . . . . . . . . . . . . . . . . . 89 . . . . . F 486
ROLSTAL Pawłowski Pawłowski Janusz . . . . . . . . . . . . . . . . . . . . . . . . . . . 92 . . . . . F 456
RIELA POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . D 290
PELLON SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 . . . . . F 484
POLNET Sp. z o.o. I WSPÓLNICY SPÓŁKA KOMANDYTOWA . . . . . . . . . . . . . . . . 84 . . . . . E 441
MADOKS Dariusz Przegaliński . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70 . . . . . C 529
OTTO TH. MENKE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . . C 45
Branżowy spis wystawców
nr str.
stoisko
ORLEN GAZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MICHALAK PRZEDSIĘBIORSTWO PRODUKCYJNO-HANDLOWO-USŁUGOWE . . . . . . . . M-ROL SPÓŁKA Z OGRANICZONĄ ODPOWIEDZIALNOŚCIĄ SP.K. . . . . . . . . . . . . . . KINGSPAN INSULATION Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
INWEST-AGRO TECHNICZNA OBSŁUGA ROLNICTWA WOJCIECH SIEŃKO . . . . . . . . . .
HOG SLAT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 . . . . . C 385
75 . . . . . . A 10
76 . . . . . C 390
62 . . . . . E 447
58 . . . . . F 470
54 . . . . . E 439
HODOWCA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54 . . . . . F 487
Sunds Alfa - Member of IBF Group . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 102 . . . . . F 464
GXL POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52 . . . . . . D 85
GENEU Beata Jerczyńska . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47 . . . . . F 491
GRUPA CB PREFABRYKACJA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 51 . . . . . F 467
FOG AGROTECHNIK POLAND Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 45 . . . . . F 463
ERICH STALLKAMP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 40 . . . . . F 482
DOZAMECH Mechanika Maszyn I Urządzeń Rolniczych Donat Zawidzki . . . . . . . . . . . 37 . . . . . C 403
INOFAMA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57 . . . . . E 438
V.V.M TECHTRADE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . E 436
WESSTRON - PRODUKT S.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 437
1403 Wyposażenie obór/Dairy equipment and instalations
AGROUNIMA PRZEDSIĘBIORSTWO WIELOFUNKCYJNE mgr inż.. Cezary Sztuder . . . . . . 14 . . . . . D 429
AGROMET PRODUKCJA MASZYN ROLNICZYCH TOMASZ ST. MATELSKI . . . . . . . . . . 12 . . . . . . . A 5
A-LIMA-BIS Przedsiębiorstwo Produkcyjno-Handlowo-Usługowe Sp. z o.o. . . . . . . . . . 16 . . . . . D 221
AVITA SŁAWOMIR RUTZ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . F 468
PRZEDSIĘBIORSTWO WIELOBRANŻOWE BORYS S.C. . . . . . . . . . . . . . . . . . . . . 88 . . . . . D 421
BAUER GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . C 201
ZAKŁADY METALOWE W PRZYSIEKACH SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . 115 . . . . . F 466
UNIMETAL SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . D 419
VOGELSANG Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . C 200
WOLF SYSTEM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 112 . . . . . D 537
ROLAND FIRMA PRODUKCJA HANDEL USŁUGI Ryszard Drąg . . . . . . . . . . . . . . . . 91 . . . . . F 488
THYE LOKENBERG-POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . E 433
TERRAEXIM-AGROIMPEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104 . . . . . E 436
SPÓŁDZIELNIA INWESTYCJI I BUDOWNICTWA W ŁOWICZU . . . . . . . . . . . . . . . . . 99 . . . . . F 465
R.J.-ROLIMPEX Przedsiębiorstwo Produkcyjno-Handlowe . . . . . . . . . . . . . . . . . . 89 . . . . . F 486
RICHEL SERRES DE FRANCE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 90 . . . . . D 551
ROLSTAL Pawłowski Pawłowski Janusz . . . . . . . . . . . . . . . . . . . . . . . . . . . 92 . . . . . F 456
PELLON SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 . . . . . F 484
POLNET Sp. z o.o. I WSPÓLNICY SPÓŁKA KOMANDYTOWA . . . . . . . . . . . . . . . . 84 . . . . . E 441
MADOKS Dariusz Przegaliński . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70 . . . . . C 529
OTTO TH. MENKE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . . C 45
ORLEN GAZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 . . . . . C 385
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
M-ROL SPÓŁKA Z OGRANICZONĄ ODPOWIEDZIALNOŚCIĄ SP.K. . . . . . . . . . . . . . . LUCAS.G . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KINGSPAN INSULATION Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
JFC POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 76 . . . . . C 390
68 . . . . . . B 27
62 . . . . . E 447
59 . . . . . F 477
HODOWCA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54 . . . . . F 487
Sunds Alfa - Member of IBF Group . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 102 . . . . . F 464
GENEU Beata Jerczyńska . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47 . . . . . F 491
GEYER&HOSAJA Sp. z o.o. Zakłady Gumowe w Partyni . . . . . . . . . . . . . . . . . . 48 . . . . . F 476
ERICH STALLKAMP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 40 . . . . . F 482
INOFAMA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57 . . . . . E 438
DAF AGRO - ANDO TECH Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . E 600
TOKO AGRI a.s. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . E 592
ENERGETYK-SERWIS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 40 . . . . . F 164
AGROCOMPLEX . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . D 547
V.V.M TECHTRADE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . E 436
1404 Technika pozyskiwania i schładzania mleka/Milking and cooling technology
A-LIMA-BIS Przedsiębiorstwo Produkcyjno-Handlowo-Usługowe Sp. z o.o. . . . . . . . . . 16 . . . . . D 221
AVITA SŁAWOMIR RUTZ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . F 468
SERWIS-CENTRUM Sp. z o.o. PRZEDSIĘBIORSTWO WIELOBRANŻOWE . . . . . . . . . . . 96 . . . . . F 475
TOKO AGRI a.s. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . E 592
AGROCOMPLEX . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . D 547
1405 Wozy paszowe i technika zadawania pasz/Feed mixing and feeding instalations
AGROMA Przesiębiorstwo Handlowe S.A. w Poznaniu . . . . . . . . . . . . . . . . . . . . 11 . . . . . A 171
A-LIMA-BIS Przedsiębiorstwo Produkcyjno-Handlowo-Usługowe Sp. z o.o. . . . . . . . . . 16 . . . . . D 221
ASAT INTERNATIONAL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20 . . . . . E 448
BLATTIN POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . B 351
BERUTEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 . . . . . E 228
BUSCHHOFF TH. GmbH & Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . C 404
CAMARA POLONIA JESUS MANUEL CAMARA PEREZ . . . . . . . . . . . . . . . . . . . . 30 . . . . . E 230
TERRAEXIM-AGROIMPEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104 . . . . . E 436
SERWIS-CENTRUM Sp. z o.o. PRZEDSIĘBIORSTWO WIELOBRANŻOWE . . . . . . . . . . . 96 . . . . . F 475
SCHUITEMAKER MACHINES B.V. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . E 131
RIELA POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . D 290
PELLON SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 . . . . . F 484
POL-STRAUTMANN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 85 . . . . . A 175
PERKOZ PRZEDSIĘBIORSTWO HANDLOWO-USŁUGOWE Sp. z o.o. . . . . . . . . . . . . . 80 . . . . . B 184
POLNET Sp. z o.o. I WSPÓLNICY SPÓŁKA KOMANDYTOWA . . . . . . . . . . . . . . . . 84 . . . . . E 441
M-ROL SPÓŁKA Z OGRANICZONĄ ODPOWIEDZIALNOŚCIĄ SP.K. . . . . . . . . . . . . . . 76 . . . . . C 390
LUCAS.G . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . . B 27
Branżowy spis wystawców
nr str.
stoisko
INWEST-AGRO TECHNICZNA OBSŁUGA ROLNICTWA WOJCIECH SIEŃKO . . . . . . . . . .
HOG SLAT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . HODOWCA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . GXL POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 58 . . . . . F 470
54 . . . . . E 439
54 . . . . . F 487
52 . . . . . . D 85
GENEU Beata Jerczyńska . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47 . . . . . F 491
GAMA P.H.U. SZEPIETOWSCY SP.J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47 . . . . . F 483
FARESIN INDUSTRIES S.P.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41 . . . . . C 207
DOBROWOLSKI MASZYNY ROLNICZE RADOSŁAW DOBROWOLSKI . . . . . . . . . . . . . 36 . . . . . . C 71
DAF AGRO - ANDO TECH Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . E 600
AGROCOMPLEX . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . D 547
V.V.M TECHTRADE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . E 436
JUNKKARI POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 294
WESSTRON - PRODUKT S.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 437
1406 Technika usuwania obornika/Solid manure removing equipment
AGROUNIMA PRZEDSIĘBIORSTWO WIELOFUNKCYJNE mgr inż.. Cezary Sztuder . . . . . . AGROMET PRODUKCJA MASZYN ROLNICZYCH TOMASZ ST. MATELSKI . . . . . . . . . . AGROMA Przesiębiorstwo Handlowe S.A. w Poznaniu . . . . . . . . . . . . . . . . . . . .
BIG DUTCHMAN SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . BAUER GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 . . . . . D 429
12 . . . . . . . A 5
11 . . . . . A 171
25 . . . . . E 434
23 . . . . . C 201
WOLF SYSTEM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 112 . . . . . D 537
TERRAEXIM-AGROIMPEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104 . . . . . E 436
ROLSTAL Pawłowski Pawłowski Janusz . . . . . . . . . . . . . . . . . . . . . . . . . . . 92 . . . . . F 456
PELLON SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 . . . . . F 484
ŁUKOMET KRZYSZTOF ŁUSZCZYK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . C 202
JFC POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59 . . . . . F 477
HOG SLAT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54 . . . . . E 439
AGROCOMPLEX . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . D 547
V.V.M TECHTRADE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . E 436
ATMP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20 . . . . . . A 12
1407 Technika zagospodarowania gnojowicy/Slurry removing and processing equipment
AGROMOTOR Tadeusz Michalak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 . . . . . . C 65
BERUTEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 . . . . . E 228
BONDIOLI & PAVESI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . . . C 61
BAUER GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . C 201
BAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . D 422
VOGELSANG Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . C 200
WOLF SYSTEM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 112 . . . . . D 537
TERRAEXIM-AGROIMPEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104 . . . . . E 436
ROLSTAL Pawłowski Pawłowski Janusz . . . . . . . . . . . . . . . . . . . . . . . . . . . 92 . . . . . F 456
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
PELLON SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
POLNET Sp. z o.o. I WSPÓLNICY SPÓŁKA KOMANDYTOWA . . . . . . . . . . . . . . . . NDS-GRZEGORZ MICHAŁEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . MEPROZET KOŚCIAN S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ŁUKOMET KRZYSZTOF ŁUSZCZYK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 . . . . . F 484
84 . . . . . E 441
HOG SLAT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . GENEU Beata Jerczyńska . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . FOG AGROTECHNIK POLAND Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . .
ERICH STALLKAMP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . AGROCOMPLEX . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
stoisko
77 . . . . . B 177
73 . . . . . D 293
69 . . . . . C 202
54 . . . . . E 439
47 . . . . . F 491
45 . . . . . F 463
40 . . . . . F 482
9 . . . . . D 547
1408 Technika utrzymania czystości w budynkach inwentarskich
/Hygiene, disinfection and cleaning equipment
AVITA SŁAWOMIR RUTZ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . F 468
ZAKŁADY METALOWE W PRZYSIEKACH SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . 115 . . . . . F 466
PELLON SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 . . . . . F 484
POLNET Sp. z o.o. I WSPÓLNICY SPÓŁKA KOMANDYTOWA . . . . . . . . . . . . . . . . 84 . . . . . E 441
JFC POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59 . . . . . F 477
GENEU Beata Jerczyńska . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47 . . . . . F 491
GEYER&HOSAJA Sp. z o.o. Zakłady Gumowe w Partyni . . . . . . . . . . . . . . . . . . 48 . . . . . F 476
FOG AGROTECHNIK POLAND Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 45 . . . . . F 463
POMOT PUP SP. Z O.O. (Chojna) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . C 276
AGRO ZAOPATRZENIE Spółka z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 . . . . . D 560
1409 Technika ogrzewania, wentylacji i klimatyzacji budynków inwentarskich
/Heating, aeration and controlled environment technology for animal housing
ACO FUNKI AS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 . . . . . E 450
ASAT INTERNATIONAL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20 . . . . . E 448
BIG DUTCHMAN SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 . . . . . E 434
WOLF SYSTEM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 112 . . . . . D 537
TERRAEXIM-AGROIMPEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104 . . . . . E 436
MARAX R.RAJ Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . E 444
SEKO KOTŁY CENTRALNEGO OGRZEWANIA . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . D 568
ROLSTAL Pawłowski Pawłowski Janusz . . . . . . . . . . . . . . . . . . . . . . . . . . . 92 . . . . . F 456
RYU ARM POLSKA JADWIGA SZCZUREK . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . E 451
PELLON SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 . . . . . F 484
POLNET Sp. z o.o. I WSPÓLNICY SPÓŁKA KOMANDYTOWA . . . . . . . . . . . . . . . . 84 . . . . . E 441
ORLEN GAZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 . . . . . C 385
INWEST-AGRO TECHNICZNA OBSŁUGA ROLNICTWA WOJCIECH SIEŃKO . . . . . . . . . . 58 . . . . . F 470
JFC POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59 . . . . . F 477
HOG SLAT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54 . . . . . E 439
Branżowy spis wystawców
nr str.
stoisko
HODOWCA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . GENEU Beata Jerczyńska . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . FIRMA USŁUGOWO-HANDLOWA DARIUSZ WICHTOWSKI . . . . . . . . . . . . . . . . . .
FOKUS P.P.H.U. RADOSŁAW FIBNER WALDEMAR STASZAK . . . . . . . . . . . . . . . . .
54 . . . . . F 487
47 . . . . . F 491
44 . . . . . F 462
45 . . . . . D 570
TYWENT Sp. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . E 586
ZAKŁADY GÓRNICZO-METALOWE „ZĘBIEC” W ZĘBCU SPÓŁKA AKCYJNA . . . . . . . . . 115 . . . . . F 147
WESSTRON - PRODUKT S.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E 437
1501 Produkcja energii z odnawialnych źródeł energii
/Renewable industrial raw materials and renewable energies
ANTINUS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . F 480
BERUTEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 . . . . . E 228
DENIS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . E 298
TEAM OF AGRA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . D 222
TERRAEXIM-AGROIMPEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104 . . . . . E 436
POL-STRAUTMANN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 85 . . . . . A 175
PROTECHNIKA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 88 . . . . . . D 89
METALERG Sp. z o.o. S.K.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74 . . . . . D 564
GEM-EKO Rafał Rogowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47 . . . . . F 458
EKO-HURT ARTUR PENKALA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 38 . . . . . D 567
AGRIKOMP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 . . . . . E 452
ZAKŁAD ŚLUSARSKI GREŃ S.J. Bolesław i Grażyna Greń . . . . . . . . . . . . . . . . . . 115 . . . . . E 453
1503 Produkcja energii z biomasy/Biomass energy plants
BERUTEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 . . . . . E 228
BAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . D 422
TEAM OF AGRA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . D 222
POL-STRAUTMANN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 85 . . . . . A 175
PROTECHNIKA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 88 . . . . . . D 89
METALERG Sp. z o.o. S.K.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74 . . . . . D 564
FLIEGL AGRARTECHNIK GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . D 220
GEM-EKO Rafał Rogowski . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47 . . . . . F 458
ZAKŁAD ŚLUSARSKI GREŃ S.J. Bolesław i Grażyna Greń . . . . . . . . . . . . . . . . . . 115 . . . . . E 453
1504 Kotły na słomę/Wood firing installations
METALERG Sp. z o.o. S.K.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74 . . . . . D 564
GIZEX PHPU Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 48 . . . . . E 590
GRASO Zenon Sobiecki . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . D 562
FOKUS P.P.H.U. RADOSŁAW FIBNER WALDEMAR STASZAK . . . . . . . . . . . . . . . . . 45 . . . . . D 570
EKO-HURT ARTUR PENKALA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 38 . . . . . D 567
ZAKŁAD ŚLUSARSKI GREŃ S.J. Bolesław i Grażyna Greń . . . . . . . . . . . . . . . . . . 115 . . . . . E 453
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
1505 Baterie słoneczne/Solar energy plants
ANTINUS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . F 480
BERUTEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 . . . . . E 228
TERRAEXIM-AGROIMPEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104 . . . . . E 436
1506 Biogazownie/Biogas plants
BERUTEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BIOPROJECT s.r.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . BIOGAZ-TECH Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BAUER GROUP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 . . . . . E 228
26 . . . . hala 40
25 . . . . . F 461
23 . . . . . C 201
BAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . D 422
VOGELSANG Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . C 200
WOLF SYSTEM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 112 . . . . . D 537
TEAM OF AGRA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . D 222
RIELA POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . D 290
POLNET Sp. z o.o. I WSPÓLNICY SPÓŁKA KOMANDYTOWA . . . . . . . . . . . . . . . . 84 . . . . . E 441
FLIEGL AGRARTECHNIK GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . D 220
GRUPA CB PREFABRYKACJA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 51 . . . . . F 467
ERICH STALLKAMP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . 40 . . . . . F 482
AGRIKOMP POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 . . . . . E 452
NIJHUIS WATER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 78 . . . . . E 584
1601 Technika komunalna/Technology for municipal applications
ATW S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21 . . . . . E 226
AGROTECHNIKA-BRUDZ WIESŁAW BRUDZ . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . . D 92
AGROMA Przesiębiorstwo Handlowe S.A. w Poznaniu . . . . . . . . . . . . . . . . . . . . 11 . . . . . A 171
AGROMIX PUP Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 . . . . . A 263
CELLI S.p.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . . B 28
CENTRUM TECHNIKI ROLNICZEJ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 31 . . . . . C 507
ZETOR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . E 297
UNIA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . C 278
PTM TRADE-CENTRUM RUCHOMYCH PODŁÓG . . . . . . . . . . . . . . . . . . . . . . . 89 . . . . . E 233
POLBOTO-AGRI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83 . . . . . . D 79
SAUTER GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 94 . . . . . F 150
SOCIETE PROMODIS (SPÓŁKA AKCYJNA SPÓŁDZIELNIA) ODDZIAŁ W POLSCE . . . . . . . 98 . . . . . B 180
RICHEL SERRES DE FRANCE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . PRZEDSIĘBIORSTWO ROMANOWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . PREMIUM TRADE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
PARTNER SYSTEMS SPÓŁKA Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . METALINVEST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . OTTO TH. MENKE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 90 . . . . . D 551
88 . . . . . D 286
86 . . . . . . B 38
80 . . . . . . D 86
74 . . . . . C 206
73 . . . . . . C 45
Branżowy spis wystawców
nr str.
stoisko
JOSKIN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 289
HEIN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52 . . . . . . B 24
FLIEGL AGRARTECHNIK GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . D 220
1602 Ciągniki i pojazdy komunalne/Tractors and municipal vehicles
AGROMA Przesiębiorstwo Handlowe S.A. w Poznaniu . . . . . . . . . . . . . . . . . . . . 11 . . . . . A 171
BARTESKO PRZEDSIĘBIORSTWO WIELOBRANŻOWE. Bartłomiej Skowroński . . . . . . . . 23 . . . . . . C 69
CENTRUM TECHNIKI ROLNICZEJ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 31 . . . . . C 507
CASE IH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . D 284
CMKS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . C 210
ZETOR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . E 297
PTM TRADE-CENTRUM RUCHOMYCH PODŁÓG . . . . . . . . . . . . . . . . . . . . . . . 89 . . . . . E 233
OTTO TH. MENKE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . . C 45
SERAFIN P.U.H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . D 294
JOSKIN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 289
HORTMASZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . E 231
HEIN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52 . . . . . . B 24
1603 Ciągniki i pojazdy komunalne - osprzęt/Tractors and municipal vehicles - accessories and spare parts
AGROMA Przesiębiorstwo Handlowe S.A. w Poznaniu . . . . . . . . . . . . . . . . . . . . 11 . . . . . A 171
BARTESKO PRZEDSIĘBIORSTWO WIELOBRANŻOWE. Bartłomiej Skowroński . . . . . . . . 23 . . . . . . C 69
BONDIOLI & PAVESI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . . . C 61
CENTRUM TECHNIKI ROLNICZEJ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 31 . . . . . C 507
CMKS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . C 210
ZETOR POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . E 297
SAUTER GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 94 . . . . . F 150
OTTO TH. MENKE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . . C 45
MICHALAK PRZEDSIĘBIORSTWO PRODUKCYJNO-HANDLOWO-USŁUGOWE . . . . . . . . 75 . . . . . . A 10
SERAFIN P.U.H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . D 294
JOSKIN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 289
HORTMASZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . E 231
HEIN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52 . . . . . . B 24
ENA LTD Sp z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 . . . . . C 597
ATMP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20 . . . . . . A 12
1604 Narzędzia i maszyny do pielęgnacji krajobrazu/Landscape maintenance equipment
AGMA F.H.U. MACIEJ KAŹMIERCZAK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 . . . . . F 134
AGROTIMH Tomasz Iwaszkiewicz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 . . . . . D 215
CENTRUM TECHNIKI ROLNICZEJ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 31 . . . . . C 507
MICHALAK PRZEDSIĘBIORSTWO PRODUKCYJNO-HANDLOWO-USŁUGOWE . . . . . . . . 75 . . . . . . A 10
MAKITA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70 . . . . . F 241
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
KELLFRI SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 62 . . . . . E 235
SERAFIN P.U.H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . D 294
HORTMASZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . E 231
HEIN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52 . . . . . . B 24
OMARV SRL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 . . . . . E 446
AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . F 305
1605 Kosiarki trawnikowe/Lawn mowers
AGMA F.H.U. MACIEJ KAŹMIERCZAK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 . . . . . F 134
AGROTIMH Tomasz Iwaszkiewicz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 . . . . . D 215
BARTESKO PRZEDSIĘBIORSTWO WIELOBRANŻOWE. Bartłomiej Skowroński . . . . . . . . 23 . . . . . . C 69
CMKS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . SAMASZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . MAKITA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
SERAFIN P.U.H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . HUSQVARNA POLAND SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . HORTMASZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
GEO Di BOERI GIOVANNA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
HEIN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . OMARV SRL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . . . .
32 . . . . . C 210
93 . . . . . D 292
70 . . . . . F 241
95 . . . . . D 294
55 . . . . . F 242
55 . . . . . E 231
47 . . . . . . . A 2
52 . . . . . . B 24
79 . . . . . E 446
17 . . . . . F 305
1606 Kosy spalinowe/Power mowers
AGMA F.H.U. MACIEJ KAŹMIERCZAK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 . . . . . MAKITA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70 . . . . . HUSQVARNA POLAND SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . HORTMASZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . F 134
F 241
F 242
E 231
HEIN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52 . . . . . . B 24
1607 Kosiarki bijakowe/Flail mowers
AGROTIMH Tomasz Iwaszkiewicz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 . . . . . D 215
CENTRUM TECHNIKI ROLNICZEJ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 31 . . . . . C 507
CMKS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . C 210
WEREMCZUK FMR Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . C 526
VOGEL&NOOT Polska Sławomir Langner . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . D 223
SAMASZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . D 292
TEHNOS d.o.o. Zalec . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104 . . . . . C 595
SALIDA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . C 402
KELLFRI SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 62 . . . . . E 235
KOWALSCY PRODUKCJA MASZYN ROLNICZYCH I CZĘŚCI ZAMIENNYCH SPÓŁKA JAWNA . 65 . . . . . . . A 1
INVENTOR JOŃSKI JAN . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 58 . . . . . . A 16
Branżowy spis wystawców
nr str.
stoisko
SERAFIN P.U.H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . D 294
HORTMASZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . E 231
GEO Di BOERI GIOVANNA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47 . . . . . . . A 2
HEIN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52 . . . . . . B 24
OMARV SRL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 . . . . . E 446
AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . F 305
1608 Kosiarki do poboczy/Verge and embankment rotovators and mowers
AGROTIMH Tomasz Iwaszkiewicz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 . . . . . D 215
CENTRUM TECHNIKI ROLNICZEJ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 31 . . . . . C 507
CMKS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . C 210
VOGEL&NOOT Polska Sławomir Langner . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . D 223
SAMASZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . D 292
SALIDA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . C 402
KELLFRI SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 62 . . . . . E 235
KOWALSCY PRODUKCJA MASZYN ROLNICZYCH I CZĘŚCI ZAMIENNYCH SPÓŁKA JAWNA . 65 . . . . . . . A 1
HORTMASZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . E 231
GEO Di BOERI GIOVANNA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47 . . . . . . . A 2
HEIN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52 . . . . . . B 24
OMARV SRL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 . . . . . E 446
1609 Zamiatarki/Sweeping machines
CENTRUM TECHNIKI ROLNICZEJ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 31 . . . . . C 507
CMKS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . C 210
CRYSTAL TRAKTOR Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . D 287
SAMASZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . D 292
TOOLMEX TRUCK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . C 375
STOMIL SANOK - DYSTRYBUCJA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . 101 . . . . . D 102
REMPRODEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 90 . . . . . F 253
PRACOWNICZY OŚRODEK MASZYNOWY W AUGUSTOWIE Sp. z o.o. . . . . . . . . . . . . 86 . . . . . C 276
PARTNER SYSTEMS SPÓŁKA Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 . . . . . . D 86
SERAFIN P.U.H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . D 294
HORTMASZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . E 231
GEO Di BOERI GIOVANNA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47 . . . . . . . A 2
HEIN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52 . . . . . . B 24
ENA LTD Sp z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 . . . . . C 597
1610 Maszyny i urządzenia do komunalnych prac ziemnych /Machinery and equipment for municipal earthwork
BROKER SERWIS MASZYNY BUDOWLANE PHU JAN SURMA . . . . . . . . . . . . . . . . 28 . . . . . . A 14
BARTESKO PRZEDSIĘBIORSTWO WIELOBRANŻOWE. Bartłomiej Skowroński . . . . . . . . 23 . . . . . . C 69
SALIDA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . C 402
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
SERAFIN P.U.H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . D 294
HEIN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52 . . . . . . B 24
MERLO POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . F 311
DAL-BO A/S . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . A 173
UTECH Maszyny i Urządzenia Techniczne Norbert Koenig . . . . . . . . . . . . . . . . . . 108 . . . . . . A 17
1611 Maszyny i urządzenia do zimowego utrzymania dróg/Equipment for winter services
APV POLSKA DANUTA MŁOCEK-BIEŻUŃSKA . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . . B 37
AGROTIMH Tomasz Iwaszkiewicz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 . . . . . D 215
BROKER SERWIS MASZYNY BUDOWLANE PHU JAN SURMA . . . . . . . . . . . . . . . . 28 . . . . . . A 14
CENTRUM TECHNIKI ROLNICZEJ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 31 . . . . . C 507
CMKS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . C 210
CRYSTAL TRAKTOR Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . D 287
SAMASZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . D 292
PRACOWNICZY OŚRODEK MASZYNOWY W AUGUSTOWIE Sp. z o.o. . . . . . . . . . . . . 86 . . . . . C 276
PARTNER SYSTEMS SPÓŁKA Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 . . . . . . D 86
MICHALAK PRZEDSIĘBIORSTWO PRODUKCYJNO-HANDLOWO-USŁUGOWE . . . . . . . . 75 . . . . . . A 10
KELLFRI SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 62 . . . . . E 235
HORTMASZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . E 231
HEIN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52 . . . . . . B 24
MERLO POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . F 311
ENA LTD Sp z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 . . . . . C 597
ATMP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20 . . . . . . A 12
AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . F 305
1612 Maszyny do kompostowania/Composting equipment and machines
BAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . D 422
SCHUITEMAKER MACHINES B.V. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . E 131
PERKOZ PRZEDSIĘBIORSTWO HANDLOWO-USŁUGOWE Sp. z o.o. . . . . . . . . . . . . . 80 . . . . . B 184
1613 Rozrzutniki kompostu/Compost spreaders
POL-STRAUTMANN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 85 . . . . . A 175
PERKOZ PRZEDSIĘBIORSTWO HANDLOWO-USŁUGOWE Sp. z o.o. . . . . . . . . . . . . . 80 . . . . . B 184
1701 Technika leśna/Forestry technology
AGROTECHNIKA-BRUDZ WIESŁAW BRUDZ . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . . D 92
AGROGRUPA BOŻENA DRABEK SPÓŁKA KOMANDYTOWO-AKCYJNA . . . . . . . . . . . . 10 . . . . . F 154
BAYWA AG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . C 199
RICHEL SERRES DE FRANCE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 90 . . . . . D 551
PREMIUM TRADE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . . B 38
PEWAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 . . . . . E 113
Branżowy spis wystawców
nr str.
stoisko
OTTO TH. MENKE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . . C 45
VRETEN AB . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . C 504
INVENTOR JOŃSKI JAN . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 58 . . . . . . A 16
SERAFIN P.U.H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . D 294
FLIEGL AGRARTECHNIK GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . D 220
UTECH Maszyny i Urządzenia Techniczne Norbert Koenig . . . . . . . . . . . . . . . . . . 108 . . . . . . A 17
ATMP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20 . . . . . . A 12
JUNKKARI POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 294
1702 Pilarki/Power saws
AGMA F.H.U. MACIEJ KAŹMIERCZAK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 . . . . . F 134
BAGRAMET SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . B 185
BAYWA AG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . C 199
MAKITA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70 . . . . . F 241
HUSQVARNA POLAND SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55 . . . . . F 242
1703 Łuparki do drewna/Firewood splitters
BAGRAMET SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . B 185
BAYWA AG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . C 199
TECHMET A.M.M.Z. JUZWA SPÓŁKA JAWNA . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . C 530
KELLFRI SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . SERAFIN P.U.H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . GEO Di BOERI GIOVANNA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
JUNKKARI POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
62 . . . . . E 235
95 . . . . . D 294
47 . . . . . . . A 2
60 . . . . . D 294
1704 Specjalne ciągniki leśne/Special forestry tractors
BARTESKO PRZEDSIĘBIORSTWO WIELOBRANŻOWE. Bartłomiej Skowroński . . . . . . . . CENTRUM TECHNIKI ROLNICZEJ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . CASE IH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ENA LTD Sp z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
23 . . . . . . C 69
31 . . . . . C 507
30 . . . . . D 284
39 . . . . . C 597
1705 Leśne maszyny uprawowe/Forestry cultivation machines
BAGRAMET SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . B 185
1801 Rolnicze środki produkcji/Farm inputs
AGRO-BIZNES SP.j. Sufarz-Rudnicki . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
SOCIETE PROMODIS (SPÓŁKA AKCYJNA SPÓŁDZIELNIA) ODDZIAŁ W POLSCE . . . . . . .
POLSIL BIOPREPARATY SPÓŁKA JAWNA . . . . . . . . . . . . . . . . . . . . . . . . . . MAŁOPOLSKA HODOWLA ROŚLIN HBP Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . .
MARKET ROLNICZY MINGE SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . .
8 . . . . . A 328
98 . . . . . B 180
84 . . . . . B 341
70 . . . . . B 360
71 . . . . . A 317
GREENOK.PL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . A 322
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
1802 Materiał siewny/Cereal seeds
AGROCHEST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . A 318
AGROYOUMIS PL. Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 . . . . . B 368
AGRO-BIZNES SP.j. Sufarz-Rudnicki . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 . . . . . A 328
AGENCJA NASIENNA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 . . . . . B 356
AGRICO POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6 . . . . . hala 7
ZAMARTE HODOWLA ZIEMNIAKA Sp. z o.o. Grupa IHAR . . . . . . . . . . . . . . . . . . 115 . . . . . hala 6
STOWARZYSZENIE POLSKI ZIEMNIAK . . . . . . . . . . . . . . . . . . . . . . . . . . . 101 . . . . . hala 9
SPÓJNIA HODOWLA I NASIENNICTWO OGRODNICZE Sp. z o.o. . . . . . . . . . . . . . . . 99 . . . . . B 363
RAPOOL POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 90 . . . . . B 367
PLANTICO - HODOWLA I NASIENNICTWO OGRODNICZE ZIELONKI Sp. z o.o. . . . . . . . . 82 . . . . . B 370
Poznańska Hodowla Roślin Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . B 361
MAŁOPOLSKA HODOWLA ROŚLIN HBP Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . 70 . . . . . B 360
MARKET ROLNICZY MINGE SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . A 317
LANTMÄNNEN SW SEED Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 67 . . . . . B 364
KAZGOD Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . A 333
KWS LOCHOW POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 67 . . . . . B 354
KWS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 67 . . . . . B 355
HODOWLA ROŚLIN SMOLICE Sp. z o.o. Grupa IHAR . . . . . . . . . . . . . . . . . . . . 54 . . . . . B 358
HZPC POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56 . . . . . B 371
HODOWLA ROŚLIN STRZELCE Sp. z o.o. Grupa IHAR . . . . . . . . . . . . . . . . . . . . 54 . . . . . B 359
GRANUM FIRMA NASIENNA J. Manias, S. Menc, J. Szymański Sp.j. . . . . . . . . . . . . 49 . . . . hala 10
FLORA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . A 330
EUROPLANT HANDEL ZIEMNIAKAMI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . 41 . . . . . B 372
EURALIS SAATEN Sp. z o.o. ODDZIAŁ W POLSCE . . . . . . . . . . . . . . . . . . . . . . 40 . . . . . B 374
DANKO HODOWLA ROŚLIN Sp. z o.o. z/s w Choryni . . . . . . . . . . . . . . . . . . . . 34 . . . . . B 357
POMORSKO MAZURSKA HODOWLA ZIEMNIAKA Sp. z o.o. w STRZEKĘCINIE . . . . . . . . 85 . . . . . hala 5
BZK Group Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . E 580
1803 Rozsada roślin/Vegetable plants
SOLAN T.CZECH, Ł.CZECH Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98 . . . . . C 521
1804 Materiał szkółkarski/Nursery materials
MARMA POLSKIE FOLIE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . C 511
1805 Nawozy mineralne/Fertilizers, mineral fertilizers
AGROCHEST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . A 318
AGRO-BIZNES SP.j. Sufarz-Rudnicki . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 . . . . . A 328
ANWIL S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18 . . . . . A 323
ARKOP PRZEDSIĘBIORSTWO SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 . . . . . A 321
BIO-WORLD Sp. z o o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . A 326
Branżowy spis wystawców
nr str.
stoisko
BM KOBYLIN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . . B 335
BOGDAN PPHU Piotr Bogdanowicz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . . B 337
YARA POLAND Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 113 . . . . . A 313
ZAKŁADY CHEMICZNE SIARKOPOL TARNOBRZEG Sp. z o.o. . . . . . . . . . . . . . . . . 115 . . . . . A 314
TECHMOT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . D 105
PRO-LAB PPHU Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87 . . . . . A 324
POLCALC Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 84 . . . . . A 331
MARKET ROLNICZY MINGE SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . A 317
LUVENA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . A 325
KAZGOD Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . A 333
K+S POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . A 312
GREENLAND TECHNOLOGIA EM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . A 329
GÓRNICZE ZAKŁADY DOLOMITOWE SPÓŁKA AKCYJNA . . . . . . . . . . . . . . . . . . . 48 . . . . hala 12
FLORA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . A 330
GRUPA AZOTY ZAKŁADY AZOTOWE KĘDZIERZYN S.A. . . . . . . . . . . . . . . . . . . . 50 . . A315,A327
GRUPA INCO S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51 . . . . . B 338
FOSFAN S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 45 . . . . . A 316
DOLOMIT Kopalnia „Ząbkowice” Przedsiębiorstwo Produkcyjno-Usługowo-Handlowe S.A. . 36 . . . . hala 13
GRUPA AZOTY ZAKŁADY CHEMICZNE POLICE S.A . . . . . . . . . . . . . . . . . . . . . 51 . A A315,E603
ENERGETYK-SERWIS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 40 . . . . . F 164
KIELECKIE KOPALNIE SUROWCÓW MINERALNYCH S.A. . . . . . . . . . . . . . . . . . . 62 . . . . hala 41
1806 Nawozy dolistne/Liquid manure
AGROCHEST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . A 318
AGRO-BIZNES SP.j. Sufarz-Rudnicki . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 . . . . . A 328
AGRARIUS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 . . . . . B 336
ARKOP PRZEDSIĘBIORSTWO SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 . . . . . A 321
BIO-WORLD Sp. z o o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . A 326
BOGDAN PPHU Piotr Bogdanowicz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . . B 337
YARA POLAND Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 113 . . . . . A 313
PRO-LAB PPHU Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87 . . . . . A 324
POLSIL BIOPREPARATY SPÓŁKA JAWNA . . . . . . . . . . . . . . . . . . . . . . . . . . 84 . . . . . B 341
MARKET ROLNICZY MINGE SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . A 317
GREENOK.PL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . A 322
KAZGOD Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . A 333
GREENLAND TECHNOLOGIA EM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . A 329
FLORA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . A 330
GRUPA AZOTY ZAKŁADY AZOTOWE KĘDZIERZYN S.A. . . . . . . . . . . . . . . . . . . . 50 . . A315,A327
GRUPA INCO S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51 . . . . . B 338
BZK Group Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . E 580
EKOFLORA SIEWIELEC TADEUSZ PRZEDSIĘBIORSTWO EKOLOGICZNE . . . . . . . . . . . 38 . . . . . E 577
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
1807 Środki ochrony roślin/Plant protection
AGROCHEST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . A 318
AGRO-BIZNES SP.j. Sufarz-Rudnicki . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 . . . . . A 328
AGROGRUPA BOŻENA DRABEK SPÓŁKA KOMANDYTOWO-AKCYJNA . . . . . . . . . . . . 10 . . . . . F 154
BEST-PEST Z.P.U.H. M, ŚWIĘTOSŁAWSKA, J. ŚWIĘTOSŁAWSKI Sp. J. . . . . . . . . . . . 24 . . . . . A 319
BIO-WORLD Sp. z o o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . A 326
BOGDAN PPHU Piotr Bogdanowicz . . . . . . . . . . . . . . . . . . . . . . . . . . . . . MARKET ROLNICZY MINGE SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . .
GREENOK.PL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KAZGOD Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . GREENLAND TECHNOLOGIA EM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . FLORA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . . B 337
71 . . . . . A 317
49 . . . . . A 322
61 . . . . . A 333
49 . . . . . A 329
44 . . . . . A 330
BZK Group Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . E 580
1808 Środki do utrzymania czystości/Cleaning products
DENIS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . E 298
TECHMOT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . D 105
MARKET ROLNICZY MINGE SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . A 317
GREENOK.PL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . A 322
GREENLAND TECHNOLOGIA EM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . A 329
FLORA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . A 330
1809 Opakowania/Packaging material
BRATPOL PRZEDSIĘBIORSTWO HANDLOWE JERZY BRATKOWSKI . . . . . . . . . . . . . 28 . . . . . C 510
TAMA POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . C 502
MARMA POLSKIE FOLIE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . C 511
DUO PLAST AG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 37 . . . . . D 563
BZK Group Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . E 580
1810 Folia rolnicza/Farm sheeting
AGROCHEST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . A 318
AGROBERG Renata i Stanisław Berg S.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 . . . . . D 101
BLATTIN POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . B 351
BIALPAK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 . . . . . C 531
BAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . . . . D 422
BRATPOL PRZEDSIĘBIORSTWO HANDLOWE JERZY BRATKOWSKI . . . . . . . . . . . . . 28 . . . . . C 510
CENTER PLAST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31 . B B362, C508
TERPLAST Sp. z o.o. Zakłady Przetwórstwa Tworzyw Sztucznych . . . . . . . . . . . . . 104 . . . . . C 520
POLSIL BIOPREPARATY SPÓŁKA JAWNA . . . . . . . . . . . . . . . . . . . . . . . . . . 84 . . . . . B 341
MARMA POLSKIE FOLIE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . C 511
MARKET ROLNICZY MINGE SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . A 317
Branżowy spis wystawców
nr str.
stoisko
RICHIGER (LANDTECHNIK GUT RENZOW GMBH) . . . . . . . . . . . . . . . . . . . . . .
FLORA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ERG BIERUŃ-FOLIE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
DEFALIN GROUP S.A. Przedsiębiorstwo Produkcyjno Handlowo Usługowe . . . . . . . . . 90 . . . . . . B 32
44 . . . . . A 330
40 . . . . . C 514
34 . . . . . C 518
1811 Sznurek do pras/Binder twines
AGROCHEST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . A 318
BIALPAK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 . . . . . C 531
BEZALIN S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 . . . . hala 25
BRATPOL PRZEDSIĘBIORSTWO HANDLOWE JERZY BRATKOWSKI . . . . . . . . . . . . . 28 . . . . . C 510
CENTER PLAST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31 . B B362, C508
WALD-GOLD Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . D 553
TAMA POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . C 502
TERPLAST Sp. z o.o. Zakłady Przetwórstwa Tworzyw Sztucznych . . . . . . . . . . . . . 104 . . . . . C 520
MARKET ROLNICZY MINGE SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . A 317
FLORA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . A 330
DEFALIN GROUP S.A. Przedsiębiorstwo Produkcyjno Handlowo Usługowe . . . . . . . . . 34 . . . . . C 518
1812 Siatka do pras/Wrapping nets for round bales
AGROCHEST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . A 318
AGROBERG Renata i Stanisław Berg S.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 . . . . . D 101
BLATTIN POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . B 351
BIALPAK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 . . . . . C 531
BEZALIN S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 . . . . hala 25
BRATPOL PRZEDSIĘBIORSTWO HANDLOWE JERZY BRATKOWSKI . . . . . . . . . . . . . 28 . . . . . C 510
CENTER PLAST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31 . B B362, C508
VOGEL&NOOT Polska Sławomir Langner . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . D 223
WALD-GOLD Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . D 553
TAMA POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . C 502
TERPLAST Sp. z o.o. Zakłady Przetwórstwa Tworzyw Sztucznych . . . . . . . . . . . . . 104 . . . . . C 520
MARKET ROLNICZY MINGE SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . A 317
FLORA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . A 330
1813 Folia do owijania bel/Stretch film sheeting for bale silage
AGROCHEST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . A 318
BIALPAK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 . . . . . C 531
BRATPOL PRZEDSIĘBIORSTWO HANDLOWE JERZY BRATKOWSKI . . . . . . . . . . . . . 28 . . . . . C 510
CENTER PLAST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31 . B B362, C508
TERPLAST Sp. z o.o. Zakłady Przetwórstwa Tworzyw Sztucznych . . . . . . . . . . . . . 104 . . . . . C 520
MARKET ROLNICZY MINGE SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . A 317
FLORA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . A 330
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
ERG BIERUŃ-FOLIE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 40 . . . . . C 514
DUO PLAST AG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 37 . . . . . D 563
1814 Pasze/Feeders
AGROCHEST Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . A 318
ARKOP PRZEDSIĘBIORSTWO SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 . . . . . A 321
BLATTIN POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . B 351
CARGILL POLAND SP. Z O.O. ODDZIAŁ W KISZKOWIE . . . . . . . . . . . . . . . . . . . . 30 . . . . . B 347
TASOMIX WYTWÓRNIA PASZ I KONCENTRATÓW . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . B 342
SCHAUMANN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . B 349
POLSIL BIOPREPARATY SPÓŁKA JAWNA . . . . . . . . . . . . . . . . . . . . . . . . . . 84 . . . . . B 341
NEOROL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KAZGOD Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . JOSERA POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . HOHBURG MINERALFUTTER GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
FLORA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . DANBRED INTERNATIONAL POLAND RAFAŁ KLEPCZYŃSKI . . . . . . . . . . . . . . . . .
77 . . . . . B 346
61 . . . . . A 333
60 . . . . . B 350
54 . . . . . B 345
44 . . . . . A 330
34 . . . . . F 471
BZK Group Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . E 580
LIRA Wytwórnia Pasz Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . E 583
1815 Dodatki paszowe/Feed admixtures
ARKOP PRZEDSIĘBIORSTWO SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 . . . . . A 321
BLATTIN POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 26 . . . . . B 351
TECHMOT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103 . . . . . D 105
SCHAUMANN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . B 349
POLSIL BIOPREPARATY SPÓŁKA JAWNA . . . . . . . . . . . . . . . . . . . . . . . . . . 84 . . . . . B 341
NEOROL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 77 . . . . . B 346
RICHIGER (LANDTECHNIK GUT RENZOW GMBH) . . . . . . . . . . . . . . . . . . . . . . 90 . . . . . . B 32
KOPALNIA SOLI KŁODAWA SPÓŁKA AKCYJNA . . . . . . . . . . . . . . . . . . . . . . . 65 . . . . . B 339
HOHBURG MINERALFUTTER GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54 . . . . . B 345
GREENLAND TECHNOLOGIA EM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . A 329
DANBRED INTERNATIONAL POLAND RAFAŁ KLEPCZYŃSKI . . . . . . . . . . . . . . . . . 34 . . . . . F 471
ENERGETYK-SERWIS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 40 . . . . . F 164
BZK Group Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . E 580
1901 Komponenty, części zamienne i osprzęt/Components, spare parts and accessories
AGROMET PRODUKCJA MASZYN ROLNICZYCH TOMASZ ST. MATELSKI . . . . . . . . . . 12 . . . . . . . A 5
AGRO-CZĘŚCI P.P.H.U. ANDRZEJ KRAUS . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . . C 49
ATW S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21 . . . . . E 226
ALFA USZCZELNIENIA TECHNICZNE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15 . . . . . . C 75
AGROBERG Renata i Stanisław Berg S.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 . . . . . D 101
Branżowy spis wystawców
nr str.
stoisko
AGE-POWER Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 . . . . . E 117
AGROMEX . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 . . . . . F 143
AGROCHŁOPECKI S.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . . A 19
ARETE CZESŁAW KLEJBUK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGROMIX PUP Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . AGROHANDLER P.P.H.U. ŁUKASZ WOŹNIAK . . . . . . . . . . . . . . . . . . . . . . . . .
AMA (SHANGHAI) TRADING Co. Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AGRO-RAMI PRZEDSIEBIORSTWO WIELOBRANZOWE RANIŚ I WSPÓLNICY S.C. . . . . . . 19 . . . . . F 145
12 . . . . . A 263
10 . . . . . F 141
16 . . . . hala 37
13 . . . . . . C 47
BULMACH SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . F 137
BRAT-MET JANIK SPÓŁKA JAWNA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28 . . . . . . D 98
BONDIOLI & PAVESI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . . . C 61
CER MOTOR Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31 . . . . . F 159
CHAPMANS AGRICULTURAL LTD . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . . B 35
ZAKŁADY SPRZĘTU MECHANICZNEGO URSUS Sp. z o.o. . . . . . . . . . . . . . . . . . 115 . . . . . D 106
ZŁOTECKI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . F 153
PHU UNI-TRADE SP.J. B. DOMAŃSKA, J. DOMAŃSKI EXPORT-IMPORT . . . . . . . . . . . 81 . . . . hala 35
VOLANT Przedsiębiorstwo Produkcyjno Handlowo Usługowe . . . . . . . . . . . . . . . . 110 . . . . . . B 30
V. ORLANDI POLAND Sp. z o.o. Sp.k. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . . D 80
TOOLMEX TRUCK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . C 375
TECHMOT Sp. z o.o. (Opole) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104 . . . . . A 320
POLBOTO-AGRI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83 . . . . . . D 79
RESTAL ZAKŁAD WYROBÓW METALOWYCH ELŻBIETA REMBIASZ . . . . . . . . . . . . . 90 . . . . . D 413
SIMENA SPÓŁDZIELNIA Z.P.CH. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97 . . . . . F 135
STEELPRESS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 . . . . . E 121
SF-FILTER Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 96 . . . . . D 108
SPAWEX Sławomir Próżanin . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 99 . . . . . . . A 6
LSN LUBLIN . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . hala 34
SOCIETE PROMODIS (SPÓŁKA AKCYJNA SPÓŁDZIELNIA) ODDZIAŁ W POLSCE . . . . . . . 98 . . . . . B 180
SITONO WYTWÓRNIA SIT KRZYSZTOF NOWAKOWSKI . . . . . . . . . . . . . . . . . . . 97 . . . . . C 386
R.J.-ROLIMPEX Przedsiębiorstwo Produkcyjno-Handlowe . . . . . . . . . . . . . . . . . . 89 . . . . . F 486
ROLMUS P.P.H.U.T. EXPORT-IMPORT MIECZYSŁAW SZYMKOWIAK . . . . . . . . . . . . . 92 . . . . . F 165
ROLNICTWO PRECYZYJNE ANDRZEJ PRZEPERSKI . . . . . . . . . . . . . . . . . . . . . 92 . . . . . . D 96
POL-STRAUTMANN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 85 . . . . . A 175
WESEM D.M.T. HAJDUK SPÓŁKA JAWNA . . . . . . . . . . . . . . . . . . . . . . . . . 111 . . . . . F 155
PEWAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 . . . . . E 113
OTTO TH. MENKE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . . C 45
MADEJSKI Spółka Jawna . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69 . . . . hala 18
MALINMAR JANINA MALINOWSKA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70 . . . . hala 17
LEMKEN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . F 308
KNOTT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 63 . . . . . . C 73
K i J S.C. Przedsiębiorstwo Wielobranżowe . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . . D 95
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
KABER GRZEGORZ SCHEINKE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . F 149
HYDROPRESS HYDRAULIKA SIŁOWA . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56 . . . . . F 161
HYDROTOR Przedsiębiorstwo Hydrauliki Siłowej S.A. . . . . . . . . . . . . . . . . . . . . 56 . . . . . F 160
HEWEA CENTRUM TECHNIKI CARGO Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . 53 . . . . hala 16
IOW SERVICE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 58 . . . . . E 123
INDUSTRIEHOF SCHERENBOSTEL HEINRICH RODENBOSTEL GmbH . . . . . . . . . . . . 56 . . . . . . C 46
INTER CARS S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57 . . . . . . C 54
HERMON CZECH & MUZIA SP.J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 53 . . . . . . B 36
HIFI FILTER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 53 . . . . hala 33
MERLO POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . F 311
FLIEGL AGRARTECHNIK GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . D 220
GUMSTAL Stanisława Lubiszewska . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51 . . . . . C 515
DIESEL CZĘŚCI Części silnikowe do maszyn budowlanych i rolniczych . . . . . . . . . . . 35 . . . . . . D 84
DIUNA SP.j. Piotr Drabiński, Jerzy Wyporkiewicz . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . F 133
DOLZAMET Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 36 . . . . . . D 93
DAV DANUTA ANDRZEJ VOGEL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 34 . . . . . D 110
ENA LTD Sp z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 . . . . . C 597
SCHAEFFLER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 94 . . . . . E 604
SERWIS-SKLEP ALTERNATORÓW I ROZRUSZNIKÓW Stanisław Osiński . . . . . . . . . . . 96 . . . . . F 144
SKRAW-MET HYDRAULIKA SIŁOWA Sp. z o.o. S.K. . . . . . . . . . . . . . . . . . . . . . 98 . . . . . . D 78
WYTWÓRNIA FILTRÓW „PZL-SĘDZISZÓW” S.A. . . . . . . . . . . . . . . . . . . . . . . 113 . . . . . D 548
ARKUS WĘŻE HYDRAULICZNE, URZĄDZENIA LAKIERNICZE . . . . . . . . . . . . . . . . 19 . . . . hala 32
AGROTRADE GRZEGORZ OSTROWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 . . . . hala 36
WYRÓB GALANTERII Z METALU WALTERSCHEID-SERVICE . . . . . . . . . . . . . . . . . 113 . . . . . A 263
MIROL Zakład Handlowo-Usługowy Mieczysław Michalski . . . . . . . . . . . . . . . . . 76 . . . . . A 263
AGRO-EKO P.W. Grzegorz Pilch . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . A 263
1902 Części do maszyn rolniczych/Spare parts for agricultural machinery
AGROMET PRODUKCJA MASZYN ROLNICZYCH TOMASZ ST. MATELSKI . . . . . . . . . . 12 . . . . . . . A 5
AGRO-CZĘŚCI P.P.H.U. ANDRZEJ KRAUS . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . . C 49
AGAT Przedsiębiorstwo Wielobranżowe Piotr Jasiński . . . . . . . . . . . . . . . . . . . . 2 . . . . . C 506
ATW S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21 . . . . . E 226
ALFA USZCZELNIENIA TECHNICZNE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15 . . . . . . C 75
AGROBERG Renata i Stanisław Berg S.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 . . . . . D 101
AGROMEX . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 . . . . . F 143
AGROCHŁOPECKI S.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . . A 19
ARETE CZESŁAW KLEJBUK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 . . . . . F 145
AGROGRUPA BOŻENA DRABEK SPÓŁKA KOMANDYTOWO-AKCYJNA . . . . . . . . . . . . 10 . . . . . F 154
ALTRO FPH JANUSZ WOŹNIAK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16 . . . . . . C 72
AGROHANDLER P.P.H.U. ŁUKASZ WOŹNIAK . . . . . . . . . . . . . . . . . . . . . . . . . 10 . . . . . F 141
AMA (SHANGHAI) TRADING Co. Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16 . . . . hala 37
Branżowy spis wystawców
nr str.
stoisko
AGRO-RAMI PRZEDSIEBIORSTWO WIELOBRANZOWE RANIŚ I WSPÓLNICY S.C. . . . . . . BAGRAMET SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BULMACH SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . BARTESKO PRZEDSIĘBIORSTWO WIELOBRANŻOWE. Bartłomiej Skowroński . . . . . . . . BRAT-MET JANIK SPÓŁKA JAWNA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 . . . . . . C 47
22 . . . . . B 185
29 . . . . . F 137
23 . . . . . . C 69
28 . . . . . . D 98
BONDIOLI & PAVESI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . . . C 61
BOHNENKAMP AG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . . E 227
CER MOTOR Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31 . . . . . F 159
CHAPMANS AGRICULTURAL LTD . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . . B 35
ZAKŁADY SPRZĘTU MECHANICZNEGO URSUS Sp. z o.o. . . . . . . . . . . . . . . . . . 115 . . . . . D 106
ZŁOTECKI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . F 153
DENIS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . E 298
PHU UNI-TRADE SP.J. B. DOMAŃSKA, J. DOMAŃSKI EXPORT-IMPORT . . . . . . . . . . . 81 . . . . hala 35
V. ORLANDI POLAND Sp. z o.o. Sp.k. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . . D 80
ROLMAKO P.H.U.T.P. HENRYK KOWALSKI . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . A 176
PETER KRÖGER GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 . . . . . E 238
TOOLMEX TRUCK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . C 375
TECHMOT Sp. z o.o. (Opole) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104 . . . . . A 320
SALIDA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . C 402
RESTAL ZAKŁAD WYROBÓW METALOWYCH ELŻBIETA REMBIASZ . . . . . . . . . . . . . 90 . . . . . D 413
SPAREX POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98 . . . . . E 115
SZARAFIN PRZEDSIĘBIORSTWO PRODUKCYJNO-HANDLOWO-USŁUGOWE . . . . . . . . 102 . . . . . F 146
STOMIL SANOK - DYSTRYBUCJA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . 101 . . . . . D 102
LSN LUBLIN . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . hala 34
SITONO WYTWÓRNIA SIT KRZYSZTOF NOWAKOWSKI . . . . . . . . . . . . . . . . . . . 97 . . . . . C 386
SITAMET WYTWÓRNIA SIT - NAPRAWA MASZYN CZYSZCZĄCYCH . . . . . . . . . . . . . 97 . . . . . D 430
R.J.-ROLIMPEX Przedsiębiorstwo Produkcyjno-Handlowe . . . . . . . . . . . . . . . . . . 89 . . . . . F 486
ROLMETAL Przedsiębiorstwo Produkcyjno Handlowe . . . . . . . . . . . . . . . . . . . . 92 . . . . . A 172
ROLMUS P.P.H.U.T. EXPORT-IMPORT MIECZYSŁAW SZYMKOWIAK . . . . . . . . . . . . . 92 . . . . . F 165
POL-STRAUTMANN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 85 . . . . . A 175
WESEM D.M.T. HAJDUK SPÓŁKA JAWNA . . . . . . . . . . . . . . . . . . . . . . . . . 111 . . . . . F 155
PEWAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 . . . . . E 113
MAGROTEX Przedsiębiorstwo Produkcyjno Usługowe Sp. z o.o. . . . . . . . . . . . . . . . 70 . . . . . C 388
OTTO TH. MENKE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . . C 45
MICHALAK PRZEDSIĘBIORSTWO PRODUKCYJNO-HANDLOWO-USŁUGOWE . . . . . . . . 75 . . . . . . A 10
MADEJSKI Spółka Jawna . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69 . . . . hala 18
MOTO-BUS WĄTROBA, ANDREARCZYK SP.J. . . . . . . . . . . . . . . . . . . . . . . . . 76 . . . . . F 139
MALINMAR JANINA MALINOWSKA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70 . . . . hala 17
LEMKEN POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . F 308
KNOTT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 63 . . . . . . C 73
K i J S.C. Przedsiębiorstwo Wielobranżowe . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . . D 95
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
KOMFORT Zakład Produkcyjno-Usługowo-handlowy . . . . . . . . . . . . . . . . . . . . 64 . . . . . . D 94
KOWALSCY PRODUKCJA MASZYN ROLNICZYCH I CZĘŚCI ZAMIENNYCH SPÓŁKA JAWNA . 65 . . . . . . . A 1
VRETEN AB . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . C 504
J.A. GĄSKA Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59 . . . . . F 132
HYDROPRESS HYDRAULIKA SIŁOWA . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56 . . . . . F 161
HYDROTOR Przedsiębiorstwo Hydrauliki Siłowej S.A. . . . . . . . . . . . . . . . . . . . . 56 . . . . . F 160
HEWEA CENTRUM TECHNIKI CARGO Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . 53 . . . . hala 16
IOW SERVICE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 58 . . . . . E 123
HERMON CZECH & MUZIA SP.J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 53 . . . . . . B 36
HIFI FILTER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 53 . . . . hala 33
FELIKS NAGLAK Przedsiębiorstwo Produkcyjno Usługowo Handlowe . . . . . . . . . . . . 43 . . . . . F 260
GERPOL SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47 . . . . . F 142
GUMSTAL Stanisława Lubiszewska . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51 . . . . . C 515
DIESEL CZĘŚCI Części silnikowe do maszyn budowlanych i rolniczych . . . . . . . . . . . 35 . . . . . . D 84
DIUNA SP.j. Piotr Drabiński, Jerzy Wyporkiewicz . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . F 133
DOLZAMET Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 36 . . . . . . D 93
DOMIX PRZEDSIĘBIORSTWO WIELOBRANŻOWE TOMASZ DOBRYCHŁOP . . . . . . . . . . 36 . . . . . F 166
DAV DANUTA ANDRZEJ VOGEL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 34 . . . . . D 110
ENA LTD Sp z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 . . . . . C 597
HF INVERTER POLSKA S.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 53 . . . . . E 589
AGRO-BIS W.Borlik . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 . . . . . E 601
SCHAEFFLER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 94 . . . . . E 604
SERWIS-SKLEP ALTERNATORÓW I ROZRUSZNIKÓW Stanisław Osiński . . . . . . . . . . . 96 . . . . . F 144
WYTWÓRNIA FILTRÓW „PZL-SĘDZISZÓW” S.A. . . . . . . . . . . . . . . . . . . . . . . 113 . . . . . D 548
ARKUS WĘŻE HYDRAULICZNE, URZĄDZENIA LAKIERNICZE . . . . . . . . . . . . . . . . 19 . . . . hala 32
AGROTRADE GRZEGORZ OSTROWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 . . . . hala 36
MIROL Zakład Handlowo-Usługowy Mieczysław Michalski . . . . . . . . . . . . . . . . . 76 . . . . . A 263
AGRO-EKO P.W. Grzegorz Pilch . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . A 263
AMAZONEN-WERKE H.DREYER GmbH+Co.KG . . . . . . . . . . . . . . . . . . . . . . . 17 . . . . . F 305
JUNKKARI POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60 . . . . . D 294
1903 Części i podzespoły do ciągników/Spare parts for tractors
AGRO-CZĘŚCI P.P.H.U. ANDRZEJ KRAUS . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . . C 49
ALFA USZCZELNIENIA TECHNICZNE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15 . . . . . . C 75
AGROBERG Renata i Stanisław Berg S.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 . . . . . D 101
AGE-POWER Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 . . . . . E 117
AGROMEX . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 . . . . . F 143
AGROCHŁOPECKI S.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . . A 19
AGROGRUPA BOŻENA DRABEK SPÓŁKA KOMANDYTOWO-AKCYJNA . . . . . . . . . . . . 10 . . . . . F 154
AGROHANDLER P.P.H.U. ŁUKASZ WOŹNIAK . . . . . . . . . . . . . . . . . . . . . . . . . 10 . . . . . F 141
AMA (SHANGHAI) TRADING Co. Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16 . . . . hala 37
Branżowy spis wystawców
nr str.
stoisko
AGRO-RAMI PRZEDSIEBIORSTWO WIELOBRANZOWE RANIŚ I WSPÓLNICY S.C. . . . . . . 13 . . . . . . C 47
BULMACH SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . F 137
BRAT-MET JANIK SPÓŁKA JAWNA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28 . . . . . . D 98
CER MOTOR Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31 . . . . . F 159
ZAKŁADY SPRZĘTU MECHANICZNEGO URSUS Sp. z o.o. . . . . . . . . . . . . . . . . . 115 . . . . . D 106
ZŁOTECKI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . F 153
ZAKŁAD NAPRAWCZY MECHANIZACJI ROLNICTWA JAN KUCHARSKI . . . . . . . . . . . 114 . . . . . D 103
V. ORLANDI POLAND Sp. z o.o. Sp.k. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 . . . . . . D 80
TOOLMEX TRUCK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . C 375
TECHMOT Sp. z o.o. (Opole) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104 . . . . . A 320
SPAREX POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98 . . . . . E 115
SIMENA SPÓŁDZIELNIA Z.P.CH. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97 . . . . . F 135
LSN LUBLIN . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . hala 34
R.J.-ROLIMPEX Przedsiębiorstwo Produkcyjno-Handlowe . . . . . . . . . . . . . . . . . . 89 . . . . . F 486
ROLMUS P.P.H.U.T. EXPORT-IMPORT MIECZYSŁAW SZYMKOWIAK . . . . . . . . . . . . . 92 . . . . . F 165
WESEM D.M.T. HAJDUK SPÓŁKA JAWNA . . . . . . . . . . . . . . . . . . . . . . . . . 111 . . . . . F 155
PEWAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 . . . . . E 113
OTTO TH. MENKE POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . . C 45
MICHALAK PRZEDSIĘBIORSTWO PRODUKCYJNO-HANDLOWO-USŁUGOWE . . . . . . . . 75 . . . . . . A 10
MADEJSKI Spółka Jawna . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69 . . . . hala 18
KNOTT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 63 . . . . . . C 73
KOMFORT Zakład Produkcyjno-Usługowo-handlowy . . . . . . . . . . . . . . . . . . . . 64 . . . . . . D 94
KABER GRZEGORZ SCHEINKE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . F 149
VRETEN AB . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . C 504
J.A. GĄSKA Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59 . . . . . F 132
HYDROPRESS HYDRAULIKA SIŁOWA . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56 . . . . . F 161
IOW SERVICE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 58 . . . . . E 123
INDUSTRIEHOF SCHERENBOSTEL HEINRICH RODENBOSTEL GmbH . . . . . . . . . . . . 56 . . . . . . C 46
HIFI FILTER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 53 . . . . hala 33
FELIKS NAGLAK Przedsiębiorstwo Produkcyjno Usługowo Handlowe . . . . . . . . . . . . 43 . . . . . F 260
DIESEL CZĘŚCI Części silnikowe do maszyn budowlanych i rolniczych . . . . . . . . . . . 35 . . . . . . D 84
DIUNA SP.j. Piotr Drabiński, Jerzy Wyporkiewicz . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . F 133
DOMIX PRZEDSIĘBIORSTWO WIELOBRANŻOWE TOMASZ DOBRYCHŁOP . . . . . . . . . . 36 . . . . . F 166
DAV DANUTA ANDRZEJ VOGEL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 34 . . . . . D 110
ENA LTD Sp z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 . . . . . C 597
SCHAEFFLER POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 94 . . . . . E 604
SERWIS-SKLEP ALTERNATORÓW I ROZRUSZNIKÓW Stanisław Osiński . . . . . . . . . . . 96 . . . . . F 144
WYTWÓRNIA FILTRÓW „PZL-SĘDZISZÓW” S.A. . . . . . . . . . . . . . . . . . . . . . . 113 . . . . . D 548
ARKUS WĘŻE HYDRAULICZNE, URZĄDZENIA LAKIERNICZE . . . . . . . . . . . . . . . . 19 . . . . hala 32
AGROTRADE GRZEGORZ OSTROWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . 14 . . . . hala 36
WYRÓB GALANTERII Z METALU WALTERSCHEID-SERVICE . . . . . . . . . . . . . . . . . 113 . . . . . A 263
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
MIROL Zakład Handlowo-Usługowy Mieczysław Michalski . . . . . . . . . . . . . . . . . 76 . . . . . A 263
AGRO-EKO P.W. Grzegorz Pilch . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . A 263
1904 Elektronika w maszynach rolniczych/Agricultural electronics
AGROCHŁOPECKI S.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . . A 19
ARETE CZESŁAW KLEJBUK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
AMA (SHANGHAI) TRADING Co. Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . .
BIURO DORADCZO-HANDLOWE JACEK KRÓL . . . . . . . . . . . . . . . . . . . . . . . .
BONDIOLI & PAVESI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 . . . . . F 145
16 . . . . hala 37
26 . . . . . E 236
27 . . . . . . C 61
TOOLMEX TRUCK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . C 375
TECHMOT Sp. z o.o. (Opole) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104 . . . . . A 320
SPAREX POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98 . . . . . E 115
LSN LUBLIN . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . hala 34
POL-STRAUTMANN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 85 . . . . . A 175
MESCOMP-OPRYSKIWACZE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74 . . . . . C 194
PRECYZYJNEROLNICTWO.COM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . D 109
IOW SERVICE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 58 . . . . . E 123
HERMON CZECH & MUZIA SP.J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 53 . . . . . . B 36
EKOTRONIC Marek Janus . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 38 . . . . . C 281
HF INVERTER POLSKA S.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 53 . . . . . E 589
1905 Oleje i smary/Lubricants and fuels
AGRO-CZĘŚCI P.P.H.U. ANDRZEJ KRAUS . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . . C 49
AGROBERG Renata i Stanisław Berg S.C. . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 . . . . . D 101
AGROGRUPA BOŻENA DRABEK SPÓŁKA KOMANDYTOWO-AKCYJNA . . . . . . . . . . . . 10 . . . . . F 154
AMA (SHANGHAI) TRADING Co. Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16 . . . . hala 37
BG POLAND Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 . . . . . F 162
PLATINUM OIL WIELKOPOLSKIE CENTRUM DYSTRYBUCJI SP. Z O.O. . . . . . . . . . . . . 83 . . . . . . C 52
TOTAL POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 106 . . . . . E 111
TOOLMEX TRUCK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . C 375
SPAREX POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98 . . . . . E 115
PNEUMAPOL JANKOWSCY SP.J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83 . . . . . F 158
OIL CENTER Sp. z o.o. Sp.k. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 78 . . . . . D 107
HYDROPRESS HYDRAULIKA SIŁOWA . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56 . . . . . F 161
INTER CARS S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57 . . . . . . C 54
FUCHS OIL CORPORATION (PL) Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 46 . . . . . . C 41
DOMIX PRZEDSIĘBIORSTWO WIELOBRANŻOWE TOMASZ DOBRYCHŁOP . . . . . . . . . . 36 . . . . . F 166
1906 Felgi/Wheel rims
ART-GUM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20 . . . . . E 119
AGRO-RAMI PRZEDSIEBIORSTWO WIELOBRANZOWE RANIŚ I WSPÓLNICY S.C. . . . . . . 13 . . . . . . C 47
Branżowy spis wystawców
nr str.
stoisko
BONDIOLI & PAVESI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . . . C 61
BOHNENKAMP AG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . . E 227
TOOLMEX TRUCK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . C 375
TECHMOT Sp. z o.o. (Opole) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104 . . . . . A 320
SOLIDEAL POLSKA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98 . . . . . E 128
MECHANIKA MASZYN I URZĄDZEŃ ROLNICZYCH TOMASZ PINKOWSKI . . . . . . . . . . . 72 . . . . . E 116
MALINMAR JANINA MALINOWSKA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70 . . . . hala 17
GRASDORF KOŁA POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . E 124
INDUSTRA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56 . . . . . F 148
1907 Opony/Tyres
ART-GUM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20 . . . . . E 119
AMA (SHANGHAI) TRADING Co. Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16 . . . . hala 37
AGRO-RAMI PRZEDSIEBIORSTWO WIELOBRANZOWE RANIŚ I WSPÓLNICY S.C. . . . . . . 13 . . . . . . C 47
BOHNENKAMP AG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . . E 227
PHU UNI-TRADE SP.J. B. DOMAŃSKA, J. DOMAŃSKI EXPORT-IMPORT . . . . . . . . . . . 81 . . . . hala 35
TOOLMEX TRUCK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . C 375
TECHMOT Sp. z o.o. (Opole) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104 . . . . . A 320
SPAREX POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98 . . . . . E 115
SOLIDEAL POLSKA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98 . . . . . E 128
PEWAG POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 . . . . . E 113
PORSCHE INTER AUTO POLSKA Sp. z o.o.- SALON VOLKSWAGEN . . . . . . . . . . . . . 86 . . . . . C 523
KABAT Spółka Jawna . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . E 129
INTER CARS S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57 . . . . . . C 54
GRASDORF KOŁA POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . E 124
INDUSTRA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56 . . . . . F 148
1908 Koła bliźniacze/Dual wheels
AGROGRUPA BOŻENA DRABEK SPÓŁKA KOMANDYTOWO-AKCYJNA . . . . . . . . . . . . 10 . . . . . F 154
BOHNENKAMP AG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . . E 227
TOOLMEX TRUCK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . C 375
PORSCHE INTER AUTO POLSKA Sp. z o.o.- SALON VOLKSWAGEN . . . . . . . . . . . . . 86 . . . . . C 523
GRASDORF KOŁA POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 49 . . . . . E 124
HERMON CZECH & MUZIA SP.J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 53 . . . . . . B 36
INDUSTRA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56 . . . . . F 148
1909 Akumulatory/Batteries
AUTOPART S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21 . . . . . . D 97
AGRO-CZĘŚCI P.P.H.U. ANDRZEJ KRAUS . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 . . . . . . C 49
AGROGRUPA BOŻENA DRABEK SPÓŁKA KOMANDYTOWO-AKCYJNA . . . . . . . . . . . . 10 . . . . . F 154
TOOLMEX TRUCK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . C 375
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
SZNAJDER F.H.U. ELŻBIETA SZNAJDER . . . . . . . . . . . . . . . . . . . . . . . . . . 102 . . . . . . D 81
OIL CENTER Sp. z o.o. Sp.k. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 78 . . . . . D 107
INTER CARS S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57 . . . . . . C 54
1910 Myjki ciśnieniowe/Cleaning equipment
AGMA F.H.U. MACIEJ KAŹMIERCZAK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 . . . . . F 134
AGROGRUPA BOŻENA DRABEK SPÓŁKA KOMANDYTOWO-AKCYJNA . . . . . . . . . . . . 10 . . . . . F 154
BONDIOLI & PAVESI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . . . C 61
PNEUMAPOL JANKOWSCY SP.J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83 . . . . . F 158
OIL CENTER Sp. z o.o. Sp.k. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 78 . . . . . D 107
MAKITA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70 . . . . . F 241
ITALCOM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59 . . . . . F 167
SERAFIN P.U.H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . D 294
HYDROPRESS HYDRAULIKA SIŁOWA . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56 . . . . . F 161
INTER CARS S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57 . . . . . . C 54
1911 Generatory prądu/Emergency power generating units, generators
AGE-POWER Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 . . . . . AGMA F.H.U. MACIEJ KAŹMIERCZAK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 . . . . . MARAX R.RAJ Sp.j. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . ENDRESS-POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 . . . . . SERWIS-SKLEP ALTERNATORÓW I ROZRUSZNIKÓW Stanisław Osiński . . . . . . . . . . . 96 . . . . . E 117
F 134
E 444
F 163
F 144
1912 Narzędzia/Tools
ART-GUM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20 . . . . . E 119
AGMA F.H.U. MACIEJ KAŹMIERCZAK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 . . . . . F 134
AMA (SHANGHAI) TRADING Co. Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16 . . . . hala 37
UNIMETAL SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . D 419
VIRAGO PRODUKT S.C. J.ŁUCZAK, A.ŁUCZAK . . . . . . . . . . . . . . . . . . . . . . . 109 . . . . . F 156
SPAREX POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98 . . . . . E 115
SIMENA SPÓŁDZIELNIA Z.P.CH. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97 . . . . . F 135
R.J.-ROLIMPEX Przedsiębiorstwo Produkcyjno-Handlowe . . . . . . . . . . . . . . . . . . 89 . . . . . F 486
PRONAR PHU DARIUSZ KAWKA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . PNEUMAPOL JANKOWSCY SP.J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . OIL CENTER Sp. z o.o. Sp.k. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ŁUCZAK MASZYNY ROLNICZE Stanisław Łuczak . . . . . . . . . . . . . . . . . . . . . . KAROL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KABER GRZEGORZ SCHEINKE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KING TONY POLSKA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ITALCOM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . HYDROPRESS HYDRAULIKA SIŁOWA . . . . . . . . . . . . . . . . . . . . . . . . . . . .
87 . . . . . D 104
83 . . . . . F 158
78 . . . . . D 107
69 . . . . . F 240
61 . . . . . D 427
61 . . . . . F 149
62 . . . . . F 157
59 . . . . . F 167
56 . . . . . F 161
Branżowy spis wystawców
nr str.
stoisko
INTER CARS S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57 . . . . . . C 54
HERMON CZECH & MUZIA SP.J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 53 . . . . . . B 36
ARKUS WĘŻE HYDRAULICZNE, URZĄDZENIA LAKIERNICZE . . . . . . . . . . . . . . . . 19 . . . . hala 32
1913 Wyposażenie warsztatów/Workshop supplies
ART-GUM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20 . . . . . E 119
AGMA F.H.U. MACIEJ KAŹMIERCZAK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 . . . . . F 134
AMA (SHANGHAI) TRADING Co. Ltd. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 16 . . . . hala 37
BG POLAND Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24 . . . . . F 162
UNIMETAL SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 . . . . . D 419
VIRAGO PRODUKT S.C. J.ŁUCZAK, A.ŁUCZAK . . . . . . . . . . . . . . . . . . . . . . . 109 . . . . . F 156
SIMENA SPÓŁDZIELNIA Z.P.CH. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97 . . . . . F 135
SITONO WYTWÓRNIA SIT KRZYSZTOF NOWAKOWSKI . . . . . . . . . . . . . . . . . . . 97 . . . . . C 386
PRONAR PHU DARIUSZ KAWKA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87 . . . . . D 104
PNEUMAPOL JANKOWSCY SP.J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83 . . . . . F 158
OIL CENTER Sp. z o.o. Sp.k. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 78 . . . . . D 107
ŁUCZAK MASZYNY ROLNICZE Stanisław Łuczak . . . . . . . . . . . . . . . . . . . . . . 69 . . . . . F 240
KAROL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61 . . . . . D 427
KING TONY POLSKA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 62 . . . . . F 157
ITALCOM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59 . . . . . F 167
INTER CARS S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57 . . . . . . C 54
HERMON CZECH & MUZIA SP.J. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 53 . . . . . . B 36
ARKUS WĘŻE HYDRAULICZNE, URZĄDZENIA LAKIERNICZE . . . . . . . . . . . . . . . . 19 . . . . hala 32
2001 Technika pomiarowa/Measuring and weighing technology
ARETE CZESŁAW KLEJBUK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 . . . . . F 145
ZUPTOR SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . D 412
ROLNICTWO PRECYZYJNE ANDRZEJ PRZEPERSKI . . . . . . . . . . . . . . . . . . . . . 92 . . . . . . D 96
HYDROPRESS HYDRAULIKA SIŁOWA . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56 . . . . . F 161
KLAUS-PETER ZANDER Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 63 . . . . . E 602
2002 Wagi elektroniczne/Electronic scales
ARETE CZESŁAW KLEJBUK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 . . . . . F 145
BUSCHHOFF TH. GmbH & Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . C 404
CZEKAŁA S.C. MARCIN CZEKAŁA & TERESA CZEKAŁA . . . . . . . . . . . . . . . . . . . 33 . . . . . E 455
ZUPTOR SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116 . . . . . D 412
ROLNICTWO PRECYZYJNE ANDRZEJ PRZEPERSKI . . . . . . . . . . . . . . . . . . . . . 92 . . . . . . D 96
DITTA SERIA Edmund Pietrzak . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 . . . . . D 216
KLAUS-PETER ZANDER Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 63 . . . . . E 602
P.H.U. TRANS STACHOWIAK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 . . . . . E 587
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
2003 Wilgotnościomierze/Hygrometers
SPAREX POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98 . . . . . E 115
ROLNICTWO PRECYZYJNE ANDRZEJ PRZEPERSKI . . . . . . . . . . . . . . . . . . . . . 92 . . . . . . D 96
MARKET ROLNICZY MINGE SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . A 317
2004 Mierniki wilgotności ziarna/Cereal sampling devices
SPAREX POLSKA SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 98 . . . . . E 115
MESCOMP-OPRYSKIWACZE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74 . . . . . C 194
SERAFIN P.U.H. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . D 294
2005 Termometry/Thermometers
MESCOMP-OPRYSKIWACZE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74 . . . . . C 194
MARKET ROLNICZY MINGE SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 71 . . . . . A 317
2006 Stacje pogodowe/Meteorological stations
AGRI CON SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 . . . . . D 100
EKOTRONIC Marek Janus . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 38 . . . . . C 281
2007 Urządzenia do pobierania prób gleby/Soil sampling devices
AGRI CON SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 . . . . . D 100
ROLNICTWO PRECYZYJNE ANDRZEJ PRZEPERSKI . . . . . . . . . . . . . . . . . . . . . 92 . . . . . . D 96
PRECYZYJNEROLNICTWO.COM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . D 109
2008 Telemetria/Telemetry
ARETE CZESŁAW KLEJBUK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19 . . . . . F 145
CASE IH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . D 284
PRECYZYJNEROLNICTWO.COM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . D 109
2101 Zarządzanie, doradztwo, instytucje rządowe, związki rolnicze
/Management, consulting services, offices
INSTYTUT ZOOTECHNIKI PAŃSTWOWY INSTYTUT BADAWCZY . . . . . . . . . . . . . . . 57 . . . . hala 22
AXMANN JERZY CHRZANOWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 . . E122,F469
POLSKIE ZRZESZENIE PRODUCENTÓW BYDŁA MIĘSNEGO . . . . . . . . . . . . . . . . . 85 . . . . . E 122
2102 Zarządzanie i doradztwo rolnicze/Management and consultancy
AGENCJA NASIENNA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 . . . . . B 356
AGRI CON SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 . . . . . D 100
BROWN & Co Spółka z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 28 . . . . . C 495
WIELKOPOLSKIE CENTRUM HODOWLI I ROZRODU ZWIERZĄT W Poznaniu z siedzibą w Tulcach Sp. z o.o. . 111
hala 14
ROLNICTWO PRECYZYJNE ANDRZEJ PRZEPERSKI . . . . . . . . . . . . . . . . . . . . . 92 . . . . . . D 96
Branżowy spis wystawców
nr str.
stoisko
PRECYZYJNEROLNICTWO.COM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
KST KONSULTING Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
FLORA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . GOSPODARZ.PL - TWÓJ PORTAL ROLNICZY . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . D 109
66 . . . . . C 496
44 . . . . . A 330
48 . . . . . . C 76
EUROPLANT HANDEL ZIEMNIAKAMI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . 41 . . . . . B 372
INOFAMA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57 . . . . . E 438
ENERGETYCZNE CENTRUM S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 . . . . . E 593
2103 Komputerowe oprogramowanie/Computer application
ROLNICTWO PRECYZYJNE ANDRZEJ PRZEPERSKI . . . . . . . . . . . . . . . . . . . . . 92 . . . . . . D 96
PRECYZYJNEROLNICTWO.COM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . D 109
LOGIS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . C 517
KST KONSULTING Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 66 . . . . . C 496
2104 Internet/Internet, online services
SANDHILLS EAST LTD-MARKETBOOK . . . . . . . . . . . . . . . . . . . . . . . . . . . GOSPODARZ.PL - TWÓJ PORTAL ROLNICZY . . . . . . . . . . . . . . . . . . . . . . . . AXMANN JERZY CHRZANOWSKI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . POLSKIE ZRZESZENIE PRODUCENTÓW BYDŁA MIĘSNEGO . . . . . . . . . . . . . . . . . 94 . . . . hala 21
48 . . . . . . C 76
22 . . E122,F469
85 . . . . . E 122
2105 Zastosowanie GPS/Global Positioning System applications
AGRI CON SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 . . . . . D 100
CASE IH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
ROLNICTWO PRECYZYJNE ANDRZEJ PRZEPERSKI . . . . . . . . . . . . . . . . . . . . . MESCOMP-OPRYSKIWACZE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . PRECYZYJNEROLNICTWO.COM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
30 . . . . . D 284
92 . . . . . . D 96
74 . . . . . C 194
86 . . . . . D 109
2106 Rolnictwo precyzyjne/Precision Farming
AGRI CON SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 . . . . . D 100
CASE IH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . D 284
POLBOTO-AGRI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83 . . . . . . D 79
STAL IMPEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 . . . . . D 542
ROLNICTWO PRECYZYJNE ANDRZEJ PRZEPERSKI . . . . . . . . . . . . . . . . . . . . . 92 . . . . . . D 96
PRECYZYJNEROLNICTWO.COM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86 . . . . . D 109
KST KONSULTING Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 66 . . . . . C 496
CLAAS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . F 302
2107 Prasa i wydawnictwa fachowe/Professional literature, specialized journals, publishers
AGRO SERWIS . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 . . . . . C 378
atr express . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20 . . . . . B 270
AKTUALNOŚCI WYDAWNICTWO TARGOWE MAŁGORZATA LAMENTA-PRZYBYLSKA . . . . 15 . . . . . hala 2
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
WIELKOPOLSKIE WYDAWNICTWO ROLNICZE Sp. z o.o. . . . . . . . . . . . . . . . . . . 111 . . . . . C 497
TARGOWA OFICYNA WYDAWNICZA Magdalena Kunikowska . . . . . . . . . . . . . . . . 103 . . . . . hala 4
SANDHILLS EAST LTD-MARKETBOOK . . . . . . . . . . . . . . . . . . . . . . . . . . . 94 . . . . hala 21
POLSKIE WYDAWNICTWO ROLNICZE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . .
MURATOR S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
INFOMAX Działowski, Lewicki, Szczepanik Z.P.Ch. Spółka Jawna . . . . . . . . . . . . . . AGROTECHNIKA - PORADNIK ROLNIKA . . . . . . . . . . . . . . . . . . . . . . . . . . .
GOSPODARZ.PL - TWÓJ PORTAL ROLNICZY . . . . . . . . . . . . . . . . . . . . . . . . 84 . . . . . . C 40
77 . . . . . C 381
57 . . . . . hala 1
13 . . C C55,C383
48 . . . . . . C 76
2108 Instytuty naukowe, uczelnie/Research, scence, Universities
PRZEMYSŁOWY INSTYTUT MOTORYZACJI . . . . . . . . . . . . . . . . . . . . . . . . . 88 . . . . . . A 11
2109 Ministerstwa, instytucje rządowe, organizacje rolnicze
/Offices, institutions and farming organizations
AGENCJA RESTRUKTURYZACJI I MODERNIZACJI ROLNICTWA . . . . . . . . . . . . . . . . 4 . . . . . C 396
AGENCJA RYNKU ROLNEGO . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4 . . . . . C 396
MINISTERSTWO ROLNICTWA I ROZWOJU WSI . . . . . . . . . . . . . . . . . . . . . . . 76 . . . . . C 396
KASA ROLNICZEGO UBEZPIECZENIA SPOŁECZNEGO Oddział Regionalny w Poznaniu . . . . 61 . . . . . C 396
GŁÓWNY INSPEKTORAT PRACY W WARSZAWIE . . . . . . . . . . . . . . . . . . . . . . 48 . . . . . C 397
2110 Transport, spedycja, logistyka/Transport services, forwarders, logistics
STILL POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101 . . . . . C 534
PORSCHE INTER AUTO POLSKA Sp. z o.o.- SALON VOLKSWAGEN . . . . . . . . . . . . . 86 . . . . . C 523
LOGIS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 68 . . . . . C 517
FLORA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . A 330
2111 Banki, leasing/Banks, leasing
CREDIT AGRICOLE BANK POLSKA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 . . . . . F 151
VB LEASING POLSKA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 109 . . . . . D 225
SIEMENS FINANCE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 96 . . . . . B 178
SG EQUIPMENT LEASING POLSKA SP. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . 96 . . . . . E 454
RAIFFEISEN-LEASING POLSKA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 89 . . . . . C 384
PORSCHE INTER AUTO POLSKA Sp. z o.o.- SALON VOLKSWAGEN . . . . . . . . . . . . . 86 . . . . . C 523
IMPULS-LEASING POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56 . . . . . . D 83
MERITUM BANK ICB S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . E 582
2112 Ubezpieczenia/Insurance
CONCORDIA UBEZPIECZENIA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . C 492
PORSCHE INTER AUTO POLSKA Sp. z o.o.- SALON VOLKSWAGEN . . . . . . . . . . . . . 86 . . . . . C 523
FLORA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . A 330
KASA ROLNICZEGO UBEZPIECZENIA SPOŁECZNEGO Oddział Regionalny w Poznaniu . . . . 61 . . . . . C 396
Branżowy spis wystawców
nr str.
stoisko
MERITUM BANK ICB S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . E 582
2201 Maszyny używane/Used machine
AGROMIX PUP Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 . . . . . A 263
BAYWA AG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . C 199
BUSCHHOFF TH. GmbH & Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . C 404
BARTESKO PRZEDSIĘBIORSTWO WIELOBRANŻOWE. Bartłomiej Skowroński . . . . . . . . 23 . . . . . . C 69
TOOLMEX TRUCK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . C 375
SALIDA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 93 . . . . . C 402
SOCIETE PROMODIS (SPÓŁKA AKCYJNA SPÓŁDZIELNIA) ODDZIAŁ W POLSCE . . . . . . . 98 . . . . . B 180
STILL POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101 . . . . . C 534
SITAMET WYTWÓRNIA SIT - NAPRAWA MASZYN CZYSZCZĄCYCH . . . . . . . . . . . . . 97 . . . . . D 430
MICHALAK PRZEDSIĘBIORSTWO PRODUKCYJNO-HANDLOWO-USŁUGOWE . . . . . . . . 75 . . . . . . A 10
VRETEN AB . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . C 504
2202 Handel maszynami używanymi/Used machine offers
BAYWA AG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . C 199
BUSCHHOFF TH. GmbH & Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . C 404
PETER KRÖGER GmbH . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 . . . . . E 238
TOOLMEX TRUCK Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 . . . . . C 375
PTM TRADE-CENTRUM RUCHOMYCH PODŁÓG . . . . . . . . . . . . . . . . . . . . . . . 89 . . . . . E 233
POLBOTO-AGRI Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 83 . . . . . . D 79
SANDHILLS EAST LTD-MARKETBOOK . . . . . . . . . . . . . . . . . . . . . . . . . . . 94 . . . . hala 21
SITAMET WYTWÓRNIA SIT - NAPRAWA MASZYN CZYSZCZĄCYCH . . . . . . . . . . . . . 97 . . . . . D 430
MICHALAK PRZEDSIĘBIORSTWO PRODUKCYJNO-HANDLOWO-USŁUGOWE . . . . . . . . 75 . . . . . . A 10
VRETEN AB . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 . . . . . C 504
DURO-FRANCE / AGRI-CONSULT Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 37 . . . . . D 213
2301 Pozostałe/Others
BM KOBYLIN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . . B 335
BM KOBYLIN ZAKŁADY MIĘSNE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . 27 . . . . . F 474
BUD-KOT ZAKŁAD BUDOWY KOTŁÓW MIROSŁAW ŚLIWA . . . . . . . . . . . . . . . . . 28 . . . . . D 561
FIRMA WW WIESŁAW WŁAZAŁEK . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44 . . . . . F 460
ZAKŁAD PRODUKCYJNO HANDLOWY STANISŁAW KRZACZEK . . . . . . . . . . . . . . . 114 . . . . . D 569
ZAKŁAD MECHANIZMÓW NAPĘDOWYCH S.C. Gabryjela Szydłowska Roman Tański . . . . 114 . . . . . F 140
TECHMOT Sp. z o.o. (Opole) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104 . . . . . A 320
SCHUITEMAKER MACHINES B.V. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95 . . . . . E 131
SITONO WYTWÓRNIA SIT KRZYSZTOF NOWAKOWSKI . . . . . . . . . . . . . . . . . . . 97 . . . . . C 386
STAL IMPEX Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100 . . . . . D 542
PLANDEKI-RASZYN MARCIN KOWALSKI . . . . . . . . . . . . . . . . . . . . . . . . . . 82 . . . . . D 541
44TUNING - PRZEDSIĘBIORSTWO 44 JOANNA HALICKA . . . . . . . . . . . . . . . . . . . 2 . . . . . C 494
Branżowy spis wystawców
List of exhibitors by trade
Branżowy spis wystawców
nr str.
stoisko
POL-CAR Przedsiębiorstwo Motoryzacyjne Sp. z o.o. . . . . . . . . . . . . . . . . . . . . PARTNER SYSTEMS SPÓŁKA Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . OSI POLAND FOODWORKS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . .
MAXYGEN P.P.H.U. EXPORT-IMPORT SYLWIA DUDEK . . . . . . . . . . . . . . . . . . . . LIBERO SP. Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
GALERIA KSEN Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . KINGSPAN INSULATION Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
IOW SERVICE Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
84 . . . . . C 522
80 . . . . . . D 86
79 . . . . . F 478
72 . . . . . F 472
68 . . . . . F 489
47 . . . . . D 556
62 . . . . . E 447
58 . . . . . E 123
ABZ ADAM ZACHAROW . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2 . . . . . D 555
EFIPOL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 38 . . . . . E 440
DANBRED INTERNATIONAL POLAND RAFAŁ KLEPCZYŃSKI . . . . . . . . . . . . . . . . . 34 . . . . . F 471
DOLZAMET Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 36 . . . . . . D 93
INOFAMA S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57 . . . . . E 438
UTECH Maszyny i Urządzenia Techniczne Norbert Koenig . . . . . . . . . . . . . . . . . . 108 . . . . . . A 17
ENERGETYCZNE CENTRUM S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39 . . . . . E 593
MERITUM BANK ICB S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73 . . . . . E 582
BZK Group Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30 . . . . . E 580
IZOLACJE PLUIMERS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59 . . . . . E 574
BEMO MOTORS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 . . . . . E 297
BIG GREEN EGG . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 . . . . . E 598
ROLKAP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91 . . . . . E 576
2302 Usługi maszynami rolniczymi/Agricultural machinery services
AGROMIX PUP Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12 . . . . . A 263
BUSCHHOFF TH. GmbH & Co. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29 . . . . . C 404
RAIFFEISEN AGRO-TECHNIKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . 89 . . . . . C 280
2303 Zbiorniki i stacje paliw/Fuel filling stations
GASPOL S.A. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 47 . . . . . D 415
WOLF SYSTEM Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 112 . . . . . D 537
SWIMER OTREMBA ŁUKASZ . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 102 . . E120, C209
. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E445
PETROCONSULTING Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81 . . . . . E 114
PARTNER SYSTEMS SPÓŁKA Z O.O. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80 . . . . . . D 86
ORLEN GAZ Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 . . . . . C 385
INDUSTRY DIESEL & OIL Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57 . . . . . . D 82
FORTIS TECHNOLOGY SP. Z O.O. SP.K. . . . . . . . . . . . . . . . . . . . . . . . . . . . 45 . . . . . . D 90
dmps.pl . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 36 . . . . . E 572
ENERGETYK-SERWIS Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 40 . . . . . F 164
CLAAS POLSKA Sp. z o.o. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32 . . . . . F 302
Centrum
Nowoczesnego Rolnictwa:
Pellon Sp. z o.o.
Pellon BioSampo
Kverneland
Kverneland Exacta TL GEOspread
JFC Polska Sp. z o.o.
Stanowisko legowiskowe - JFC Deluxe
Bauer Group Polska
Separator PSS 3.3-780
Sipma S.A.
Owijarka bel OR 7532 DIANA
Łuczak Maszyny Rolnicze
Maszyna do pielęgnacji roślin: Eko pielnik E1-2N
S.C. Tomit Agri Maccine S.R.L.
Strip Hawk
Kockerling GmbH & Co.KG
Technologia Strip-Till w uprawie buraków, kukurydzy, rzepaku i zbóż „Master”
Pokazy maszyn w Ringu
(nowości, opryskiwacze, ładowarki i ładowacze czołowe)
Presentation of machines in the Ring
(new machines, field sprayers,
telescopic loaders and front loaders)
Pokazy polowe
Korbanek sp. z o.o.
ul. Poznańska 159
62-080 Tarnowo Podgórne
tel.: +48 61 895 03 00
e-mail: [email protected]
www.korbanek.pl
Korbanek sp. z o.o.
ul. Poznańska 159
62-080 Tarnowo Podgórne
tel.: +48 61 895 03 00
e-mail: [email protected]
www.korbanek.pl
2
Massey Ferguson 956 + 5609
Massey Ferguson 9205
Ładowacz czołowy Massey Ferguson model 956 reprezentuje serię ładowaczy czołowych 900. Maksymalna wysokość podnoszenia do punktu obrotu ramki wynosi 4 m, a
maksymalny udźwig na wysięgniku opuszczonym 2070
kg. Wysięgnik z poziomowaniem mechanicznym posiada
instalację trzysekcyjną, system szybkiego montażu i stopy
podporowe. Do tłumienia wstrząsów służy amortyzator
drgań SoftDrive. Absolutną nowością niespotykaną do
tej pory jest joystick do obsługi ładowacza. Oprócz standardowych funkcji sterowania ładowaczem można nim
obsługiwać również przekładnię napędową. Operator za
pomocą tego joysticka może zmieniać kierunek jazdy ciągnika i zmieniać półbiegi. Dzięki temu rozwiązaniu operator
może jedną dźwignią sterować ładowaczem czołowym
i ciągnikiem przez co praca jest łatwiejsza a wydajność
wyższa. Ciągnik Massey Ferguson 5609 to reprezentant
nowej serii 5600. Ciągniki Massey Ferguson serii 5600
posiadają wyprofilowaną, ściętą maskę silnika zapewniającą znakomitą widoczność podczas pracy z ładowaczem
czołowym. Ponadto można wyposażyć je w przeszklony
luk dachowy gwarantujący dobrą widoczność na ładowacz
podczas załadunku na duże wysokości. Moc maksymalna
modelu 5609 wynosi 95 KM przy obrotach silnika 2000
obr./min. Przekładnia napędowa to dobrze znana Dyna4
posiadająca 16 przełożeń do przodu i 16 do tyłu. Dźwignia
rewersu elektrohydraulicznego Power Control umieszczona
z lewej strony kierownicy umożliwia: zmianę kierunku jazdy, zmianę przełożeń oraz ustawienie przekładni w pozycji
neutralnej.
Ładowarka teleskopowa Massey Ferguson 9205 reprezentuje serię 9000. Jest to kompaktowa i najmniejsza maszyna z tej serii przeznaczona do pracy w ciasnych budynkach
i obejściach, jednym słowem wszędzie tam gdzie brakuje
miejsca. Znakomita zwrotność gwarantuje łatwość pracy
i obsługi oraz maksymalną wydajność każdej czynności.
Kabina jest przestronna i komfortowa. Wyposażono ją
w joystick do obsługi funkcji hydraulicznych. Wysokość
ładowarki wynosi 199 cm a szerokość 184 cm. Udźwig
maksymalny to 2200 kg a maksymalna wysokość podnoszenia 5,2 m. Zasięg teleskopu wynosi 3 m. Układ hydrauliczny zasila pompa o wydatku oleju 85 l/min. Ładowarka
ta posiada hydrostatyczną przekładnię napędową z dwoma
mechanicznymi zakresami. Prędkość maksymalna wynosi
25 km/h. Przekładnia posiada ponadto zakres prędkości
pełzających z funkcją Speed Control System – czyli możliwością precyzyjnego ustawienia prędkości jazdy. Do napędu zastosowano 4 cylindrowy silnik marki Kubota o mocy
75 KM. Ładowarka posiada 3 tryby skrętu kół: możliwość
skrętu przednimi kołami, czterema kołami i „psi chód”.
Waga jej wynosi 4695 kg. Standardowo wyposażona jest
w: parę wyjść hydraulicznych na końcu teleskopu, zaczep
tylny, oświetlenie robocze z przodu i tyłu, światło ostrzegawcze „kogut”.
Pokazy polowe
Kramer-Werke GmbH
Wacker Neuson Str. 1
88630 Pfullendorf
Tel.: +49/(0)7552/9288-0
Fax: +49/(0)7552/9288-234
e-mail: [email protected]
Kramer-Werke GmbH
Wacker Neuson Str. 1
88630 Pfullendorf
Tel.: +49/(0)7552/9288-0
Fax: +49/(0)7552/9288-234
e-mail: [email protected]
Teleładowarka KRAMER KL35T
Ładowarka teleskopowa KRAMER KT256
Teleładowarka Kramer KL35T to przedstawiciel kompaktowych ładowarek kołowych firmy Kramer z wysięgnikiem
teleskopowym do uniwersalnego zastosowania w rolnictwie
i gospodarce komunalnej. Wysięgnik teleskopowy umożliwia załadunek na wysokość ponad 4,5 metra. Dzięki temu
można obsługiwać wszystkie samochody i bez problemu
układać ładowane baloty w stosy. Ładowarka posiada homologację ciągnikową dzięki sztywnej ramie i przedniej osi
skrętnej oraz przekładni Eco Speed i jest uniwersalnym pomocnikiem w każdej sytuacji, a dzięki hamulcom pneumatycznym może holować przyczepy o ciężarze nawet do 14
ton. Wszystkie ładowarki kołowe i teleładowarki wyróżniają
się typowymi dla firmy Kramer cechami konstrukcyjnymi:
sztywna rama zapewnia optymalną stabilność i stałą nośność; niebywała zwrotność dzięki obu skrętnym osiom;
znakomita widoczność wokół pojazdu i bezpieczne wejście
gwarantują maksymalne bezpieczeństwo podczas eksploatacji. Koncepcja Kramera zapewnia wysoką uniwersalność
użytkową ze szczególnym naciskiem na wydajność, moc i
bezpieczeństwo! Aby osiągnąć maksymalną elastyczność,
wszystkie ładowarki kołowe i teleładowarki Kramera są seryjnie wyposażane w szybkozłącza hydrauliczne. Opcjonalnie dostępne są dodatkowe obwody sterownicze i wydajny
układ hydrauliczny typu „powerflow”. Projektanci Kramera
przykładają dużą wagę do prostoty obsługi i łatwości konserwacji. Do maszyny można wsiadać z obu stron. Kolumna
kierownicy, fotel i podłokietniki dają się w prosty sposób
dopasować do każdego kierowcy, a dzięki wielofunkcyjnemu joystickowi operator ma wszystkie elementy obsługi w
jednej ręce! Poprzecznie montowany silnik optymalizuje stosunek mocy do masy, zapewniając jeszcze większą wydajność tych zwrotnych maszyn i umożliwia jednocześnie łatwy
i bezpieczny dostęp do wszystkich punktów konserwacji.
Kramer ma w ofercie 2 typy ładowarek teleskopowych o
nośności 1,2 i 2,5 tony oraz wysokości podnoszenia od 4,5
do 6 m. Maszyny wyróżniają się kompaktowymi wymiarami
i innowacyjnym systemem wspomagania operatora Smart
Handling. Smart Handling wspomaga operatora wykonując
samoczynne, optymalne manewry, co podnosi wydajność
i komfort pracy i jednocześnie spełnia surowe europejskie
przepisy bezpieczeństwa. Doskonałe parametry techniczne:
nośność użytkowa 2,5 tony przy wysokości podnoszenia
5,75 m. Poza tym Kramer KT 256 jest zbudowany bardzo
kompaktowo i mimo swoich znakomitych parametrów
mieści się w wymiarach 2 x 2 m. Nowoczesny, elektronicznie regulowany hydrostat wysokociśnieniowy gwarantuje
maksymalną dynamikę jazdy i doskonałą trakcję. Wyjątkowo mocna budowa ramy, wysięgnika i czoła szybkozłącza
zapewniają trwałość nawet w najtrudniejszych warunkach
użytkowania – dzięki temu jest to nośnik teleskopowy o
właściwościach ładowarki kołowej! Nowoczesna i wygodna kabina z joystickiem typu „Wszystko w Jednym” i panoramiczna szyba przednia umożliwiają kierowcy wydajną,
ergonomiczną pracę i kontrolę wszystkich funkcji. Szeroki
wybór ogumienia dostosowywanego do potrzeb zapewnia
stabilność i doskonałą trakcję. KRAMER to: bezpieczeństwo
- wydajność – wszechstronność.
3
Pokazy polowe
Merlo Polska Sp. z o.o.
Ul. Warszawska 109, I p.
05-092 Łomianki
kom.: +48 698 177 176
e-mail: [email protected]
www.merlo.com, www.merlo.pl
AGCO Sp. z o.o.
ul. Poznańska 5, 62-021 Paczkowo
tel. +48 61 662 90 50, 61 662 90
54+48 61 662 90 53 (serwis)
fax +48 61 662 90 58
e-mail: [email protected]
POLSKA
NOWOŚĆ
4
MF 309 CID
Massey Ferguson 5610 + 956
Ładowarka teleskopowa z TUZ tj. trzypunktowym układem
zawieszenia i z WOM tj. wałkiem odbioru mocy. Ładowarka serii MULTIFARMER to idealna maszyna dla rolnictwa
zastępująca m.in. ciągnik rolniczy średniej mocy w gospodarstwie. Zastosowanie: prace polowe, prace magazynowe
(załadunek nawozów, zboża, big bag czy inne) czy w hodowli. Silnik 120 KM (w opcji do 156 KM). Przekładnia hydrostatyczna 4 x 4 oznacza m.in. bardzo płynne sterowanie
precyzyjną jazdą, hamowanie skrzynią itd. Elektro – hydrauliczny przełącznik jazdy „Shift on the go” – zmiana biegu
w trakcie jazdy, TUZ kategorii I, wałek WOM (oferujemy
wybór parametrów dodatkowych), teleskop trzyramienny
o wys. podnoszenia 9 m (w opcji 6 m wys. podnoszenia),
- tempomat (możliwość ustawienia stałej prędkości kroczącej przy wysokich obrotach silnika), blokada mechanizmu
różnicowego na tylną oś, blokada przedniej lub tylnej osi w
zależności od zastosowania jako ładowarka teleskopowa
lub jako typowy ciągnik rolniczy. Ergonomiczny joystick
4 x 1, elektro-proporcjonalny. Tac-Lock ZM2, karetka z
automatycznym blokowaniem osprzętu bez konieczności
wysiadania z kabiny. Wyrównanie poziomu ramą i… wiele
innych. Dodatkowo maszyna jest niezwykle kompaktowa a
jej wymiary to: szerokość 2.250mm, wysokość 2.495 mm,
długość 5.130mm. Waga 7.000 kg. Maksymalny zasięg
teleskopu do przodu to 5.600mm. Ładowarka może się
poruszać z prędkością do 40 km /h. Zwrotność podnoszą
wszystkie koła skrętne. Jednocześnie dostępny jest system
skrętu kół typu krab, ew. przednie koła skrętne. Duże szyby i
pełnowymiarowa kabina zapewniają doskonałą widoczność
zakresie 360 stopni, zaś duże drzwi, otwierane w pełnym
zakresie tj. 180 stopi są także przeszklone w dolnej części
dla lepszej obserwacji tego co dzieje się z boku ładowarki.
Ciągnik Massey Ferguson 5610 to reprezentant nowej serii
5600. Ciągniki Massey Ferguson serii 5600 posiadają wyprofilowaną, ściętą maskę silnika zapewniającą znakomitą
widoczność podczas pracy z ładowaczem czołowym. Ponadto można wyposażyć je w przeszklony luk dachowy
gwarantujący dobrą widoczność na ładowacz podczas
załadunku na duże wysokości. Moc maksymalna modelu
5610 wynosi 105 KM przy obrotach silnika 2000 obr./min.
Przekładnia napędowa to dobrze znana Dyna4 posiadająca 16 przełożeń do przodu i 16 do tyłu. Dźwignia rewersu
elektrohydraulicznego Power Control umieszczona z lewej
strony kierownicy umożliwia: zmianę kierunku jazdy, zmianę
przełożeń oraz ustawienie przekładni w pozycji neutralnej.
Ciągnik wyposażony jest w ładowacz czołowy Massey Ferguson model 956. Maksymalna wysokość podnoszenia do
punktu obrotu ramki wynosi 4 m, a maksymalny udźwig na
wysięgniku opuszczonym 2070 kg. Wysięgnik z poziomowaniem mechanicznym posiada instalację trzysekcyjną,
system szybkiego montażu i stopy podporowe. Do tłumienia
wstrząsów służy amortyzator drgań SoftDrive. Absolutną
nowością niespotykaną do tej pory jest joystick do obsługi
ładowacza. Oprócz standardowych funkcji sterowania ładowaczem można nim obsługiwać również przekładnię napędową. Operator za pomocą tego joysticka może zmieniać
kierunek jazdy ciągnika i zmieniać półbiegi. Dzięki temu rozwiązaniu operator może jedną dźwignią sterować ładowaczem czołowym i ciągnikiem przez co praca jest łatwiejsza
a wydajność wyższa.
Pokazy polowe
Lely East Sp. z o.o.
Ciele, ul. Toruńska 18
86-005 Białe Błota
tel. +48 523 211 133
e-mail: [email protected]
www.lely.com
Lely East Sp. z o.o.
Ciele, ul. Toruńska 18
86-005 Białe Błota
tel. +48 523 211 133
e-mail: [email protected]
www.lely.com
NOWOŚĆ
NOWOŚĆ
Splendimo PC 370 RS
Tigo XR100
Nowe kosiarki Lely Splendimo PC 330 i PC 370 o szerokości
roboczej 3,25m i 3,65m zaprojektowano z myślą o przyszłości.
Kosiarki wyposażone są w nową modułową listwę tnącą Lely
Splendimo. Zapewnia ona wyższą prędkość roboczą oraz wymaga mniejszej konserwacji. System Klipsowy Splendimo jest
standardem. W przypadku uderzenia nóż o długości 12cm ma
możliwość obrócenie się o 360 stopni. Nowatorska konstrukcja maszyny zapewnia dużą przepustowość nawet wilgotnego
i ciężkiego materiału podczas prędkości pracy dochodzących
do 30km/h! Listwa tnąca zawieszona jest hydropneumatycznie.
Równoległoboczna rama na której zawieszona jest listwa tnąca
jest bezpośrednio połączona z szerokimi kołami transportowymi, zapewniającymi szybkie podnoszenie i opuszczanie maszyny na uwrociach. Opatentowana listwa tnąca Splendimo składa
się dysków oraz elementów dystansowych. Wszystkie elementy połączone są za pomocą śruby ze stali chromowej. System
zapewnia możliwość zestawienia dowolnej liczby dysków różnorodny zakres szerokości roboczej, zmianę kierunku obrotów,
proste przekazanie napędu. Umożliwia także proste serwisowanie maszyn - wszystkie moduły są identyczne! Główną atutem
listwy tnącej Splendimo jest unikatowy system napędu. Każdy
dysk napędzany jest bezpośrednio z wałka. W innych kosiarkach napęd przekazywany jest kolejno przez przekładnie zębate
dysków, co powoduje stratę energii. Efektem czego kosiarki
Lely porównując do konkurencji pracują z ciągnikami o mniejszej mocy. Wałek jest wykonany z wysokogatunkowej stali
i przechodzi przez środek wszystkich dysków. Dostarcza potrzebną moc bezpośrednio do każdego dysku! Listwa Lely ma
o 15-20% większą sprawność i niższe zużycie energii w stosunku do rozwiązań maszyn konkurencyjnych. Im większe są
szerokości robocze i liczba dysków, tym różnica w sprawności
na korzyść Splendimo rośnie. Jest to wyraźnie odczuwalne
w zużyciu paliwa!
Przyczepy z serii Tigo XR wykonane są na podstawie zupełnie nowego i oryginalnego pomysłu Inżynierów Lely. Mogą
być używane za równo jako przyczepy samozbierające, jak i
przyczepy do transporty kiszonki. Nowatorska nadbudowa ze
zintegrowaną wielofunkcyjną przegrodą, której ustawianie jest
regulowane hydraulicznie, umożliwia dodatkowe ładowanie
materiału do przestrzeni ponad zespołem podającym. Oznacza to, że przyczepa mieści więcej materiału, a jest jednocześnie krótsza. Cały zespół załadowczy został skonstruowany
z uwzględnieniem najbardziej ekstremalnych warunków.
Przyczepa z serii Tigo XR firmy Lely to wyznacznik nowych
standardów dla przyczep typu Combi. Tnący i podający wirnik
o bardzo wysokiej wydajności i średnicy 800mm wyposażony
w kanał podający o szerokości 1750mm, zapewnia znakomitą
wydajność. Wykonane ze stali nadwęglanowej palce o szerokości 25mm, rozlokowane w siedmiu spiralnie ułożonych
rzędach, to z kolei gwarancja do płynnego i doskonałego cięcia. Minimalna długość cięcia wynosi 37mm. W wyniku zastosowanie powyższych rozwiązań udało się stworzyć wysokiej
jakości, która idealnie wstępne zagęszcza paszę do przeżuwaczy i może być dokładnie wypełniona aż po sam brzeg. Nowy,
Bezkrzywkowy podbieracz XR ma 200cm szerokości i wyposażony jest w siedem rzędów palców rozmieszczonych w niewielkiej odległości od siebie (zaledwie 5,4 cm), co zapewnia
czyste i skuteczne podbieranie. Prędkości obrotowe wirnika
oraz podbieracza są skoordynowane w sposób zapewniający
znakomity przepływ zielonki oraz bardzo wysoką wydajność
podbierania. Zespół jezdny przyczepy Tigo XR to zupełnie
nowe rozwiązanie przygotowane z myślą o niezawodności w
trudnych warunkach. Każdy nóż jest indywidualnie chroniony
przed ciałami obcymi za pomocą systemu Trimatic, sprężyna
zwalniająca wygina się i obniża siłę nacisku na nóż zapobiegając tym samym uszkodzeniu wirnika i noża.
5
Pokazy polowe
Agrifac Machinery B.V.
Eesveenseweg 15
8332 JA Steenwijk, Holandia
Jarosław Kowalewski, tel. +48 695 746 901
e-mail: [email protected]
www.agrifac.pl
6
Agromet Pilmet Sp. z o.o.
ul. Fabryczna 2
49-301 Brzeg
tel.: +48 77 444 45 02
fax: +48 77 416 20 80
www.uniagroup.com
Condor
ERA 4024
Condor to top model wszystkich opryskiwaczy produkowanych przez Agrifac. Nadaje się idealnie do każdego rodzaju oprysku od siewu aż po zbiór. Jego charakterystyczne cechy, takie jak regulacja szerokości roboczej (do 51
m), duża pojemność zbiornika głównego (5.000 l) oraz hydrauliczna kontrola rozstawu kół (150 – 225 cm)(opcjonalne: 225-330 cm, Condor WideTrackPlus), stawiają wysoko
poprzeczkę konkurentom. Dodatkowymi zaletami, które na
pewno docenią profesjonaliści, jest 125 cm (opcjonalne:
200 cm, Condor ClearancePlus) wysokość robocza oraz
hydrauliczny napęd i sterowanie czterema kołami.
Producent: PILMET. Szerokość belki: 24 m. Opryskiwacze
polowe ERA, przyczepiane, o pojemnościach 4200 i 5800
l produkowane w fabryce UNII w Brzegu wyposażane są w
belki polowe wykonane z giętych profili zapewniających dużą
sztywność i wszechstronność oraz niewielką szerokość transportową. Opryskiwacze dedykowane są użytkownikom wykorzystującym wielofunkcyjne i bardziej rozbudowane układy
składania belki, oparte na sterowaniu elektrohydraulicznym.
Wykorzystując zamontowany na opryskiwaczu komputer
UNIA Terminal System z przyłączem ISOBUS, możliwa jest
jednoczesna realizacja następujących funkcji: • regulacja
dawki oprysku • sterowanie armaturą oprysku, sterowanie i
kontrola układu hydraulicznego, • automatyczne prowadze-nie
maszyny po śladach ciągnika – AXIS –Control • automatyczne podnoszenie i pochylanie belki polowej – DYSTANS Control
• automatyczne sterowanie sekcjami roboczymi – SECTION
-Control z wykorzystaniem techniki GPS •prowadzenie opryskiwacza w jeździe równoległej i konturowej – GPS – darmowy
sygnał EGNOS, E-EDS -elektryczne sterowanie pracą pojedynczych rozpylaczy łącznie z cyrkulacją cieczy. Belka polowa:
dostępne szerokości robocze: 24,27 i 36 m – prezentowany
model to 24 m; sztywna i trwała belka polowa; rozbudowany
układ stabilizacji oparty na układzie wahadłowym z amortyzacją pionową i poziomą; głowice 4 pozycyjne z kompletem
rozpylaczy. Zbiornik: poliestrowy – z gładkimi ściankami wewnętrznymi; dwa boczne zbiorniki wody czystej do płukania
układu po 300 l każdy; stabilne falochrony stanowiące jednocześnie wzmocnienie konstrukcji zbiornika; płuczki wirowe
zbiornika głównego. Oś skrętna: oś skrętna z prowadzeniem
manualnym przez operatora lub w pełni automatycznym
sterowanym czujnikiem żyroskopowym. Układ sterowania
umożliwia prowadzenie opryskiwacza po śladach ciągnika lub
z przesunięciem zaczepu, umożliwiając „psi chód”.
Pokazy polowe
Kujawska Fabryka Maszyn
Rolniczych Sp. z o.o.
Kolejowa 54
87 880 Brześć Kujawski
tel.: +48 54 252 10 27
www.krukowiak.com.pl
Agromet Pilmet Sp. z o.o.
ul. Fabryczna 2
49-301 Brzeg
tel.: +48 77 444 45 02
fax: +48 77 416 20 80
www.uniagroup.com
EUROPA premium 4024
GOLIAT PLUS
Producent: AGROMET PILMET, szerokość belki: 24 m. Opryskiwacze polowe EUROPA premium przyczepiane, o pojemnościach 4200 i 5800 l produkowane w fabryce UNII GROUP
w Brzegu wyposażane są w belki polowe wykonane z giętych
profili zapewniających dużą sztywność i wszechstronność
oraz niewielką szerokość transportową. Opryskiwacze dedykowane są użytkownikom wykorzystującym wielofunkcyjne i
bardziej rozbudowane układy składania belki, oparte na sterowaniu elektro-hydraulicznym. Wykorzystując zamontowany na
opryskiwaczu komputer UNIA Terminal System z przyłączem
ISOBUS, możliwa jest jednoczesna realizacja następujących
funkcji: • regulacja dawki oprysku • sterowanie armaturą
oprysku, •sterowanie i kontrola układu hydraulicznego, • automatyczne prowadzenie maszyny po śladach ciągnika – AXIS
–Control • automatyczne podnoszenie i pochylanie belki polowej – DYSTANS Control • automatyczne sterowanie sekcjami
roboczymi – SECTION -Control z wykorzystaniem techniki
GPS •prowadzenie opryskiwacza w jeździe równoległej i konturowej – GPS – darmowy sygnał EGNOS, E-EDS -elektryczne
sterowanie pracą pojedynczych rozpylaczy łącznie z cyrkulacją
cieczy.
Opryskiwacz rolniczy przyczepiany GOLIAT PLUS to przedstawiciel zmodernizowanej rodziny opryskiwaczy dla profesjonalnego rolnictwa. Prezentowany model posiada zbiornik o
pojemności 4200 litrów wykonany z polietylenu, kształt zbiornika umożliwił obniżenie środka ciężkości na tyle, aby możliwe
było jego bezpieczne użytkowanie nawet na dużych nierównościach terenu. Belka polowa typu PHB o szerokości 24
metrów jest sterowana w pełni elektrohydraulicznie, umożliwia
niezależne składanie ramion, a nawet ich części, co znacznie
ułatwia wykonywanie zabiegów na polach z licznymi przeszkodami, takimi jak słupy elektryczne. Wymuszona hydraulicznie
stabilizacja belki oraz zmienna geometria pozwala dopasować
położenie belki do profilu pola, dzięki czemu zabieg może być
wykonywany zawsze z optymalnej wysokości. Pneumatyczna
amortyzacja osi oraz nowe zawieszenie belki poprawiło znacząco nie tylko jej stabilizację ale także znacznie zwiększyło
stopień amortyzacji belki, dzięki czemu drgania z podłoża nie
są przenoszone na belkę.
W prezentowanym modelu został zastosowany komputer
sterujący BRAVO 400S z systemem sterowania głowicami
SeleTRON. Zestaw ten pozwala na włączanie i wyłączanie
pojedynczych głowic belki w zależności od potrzeb w oparciu
o sygnał GPS. Ponadto komputer może współpracować z innymi maszynami rolniczymi jako uniwersalna nawigacja GPS.
Rodzina opryskiwaczy GOLIAT PLUS obejmuje modele od
2500 do 6000 litrów pojemności, które można wyposażyć w
belki hydraulicznie sterowane od 18 do 36 metrów, w tym belki
aluminiowe.
7
Notatki
Notes
.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
....................................................................................................................................................
.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
....................................................................................................................................................
Notatki
Notes
.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
....................................................................................................................................................
.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
....................................................................................................................................................
Notatki
Notes
.. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
.....................................................................................................................................................
......